Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.67
PubTator Score 4.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.700 6.5e-05
Astrocytoma, Pilocytic -1.400 3.0e-06
atypical teratoid / rhabdoid tumor -1.900 3.1e-08
ependymoma -1.200 9.5e-03
glioblastoma -1.400 2.8e-08
group 4 medulloblastoma 1.100 2.0e-02
medulloblastoma, large-cell -1.500 1.5e-04
osteosarcoma -1.115 7.6e-04
psoriasis -1.100 3.8e-04

Gene RIF (5)

AA Sequence

MSILIIEAFYGGSHKQLVDLLQEELGDCVVYTLPAKKWHWRARTSALYFSQTIPISEHYRTLFASSVLNL      1 - 70
TELAALRPDLGKLKKILYFHENQLIYPVKKCQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKF     71 - 140
MKLIPDHRPKDLESIIRPKCQVIYFPIRFPDVSRFMPKHKTTHLKKMLGLKGNGGAVLSMALPFQPEQRD    141 - 210
SEDLLKNFNSECDTHCGLDTARQEYLGNSLRQESDLKKSTSSDNSSSHHGENKQNLTVDPCDILGGVDNQ    211 - 280
QRLLHIVWPHRWEHDKDPESFFKVLMHLKDLGLNFHVSVLGETFTDVPDIFSEAKKALGSSVLHWGYLPS    281 - 350
KDDYFQVLCMADVVISTAKHEFFGVAMLEAVYCGCYPLCPKDLVYPEIFPAEYLYSTPEQLSKRLQNFCK    351 - 420
RPDIIRKHLYKGEIAPFSWAALHGKFRSLLTTEPREDL                                    421 - 458
//

Text Mined References (11)

PMID Year Title