Property Summary

NCBI Gene PubMed Count 11
PubMed Score 21.53
PubTator Score 5.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 1.8e-10

 MGI Phenotype (1)

Protein-protein Interaction (4)

Gene RIF (4)

AA Sequence

MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDGDFILTESSAI      1 - 70
LIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLGPLIGVQVPEEKVERNRTAMD     71 - 140
QALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALGYELFEGRPRLAAWRGRVEAFLGAELCQEAH    141 - 210
SIILSILEQAAKKTLPTPSPEAYQAMLLRIARIP                                        211 - 244
//

Text Mined References (17)

PMID Year Title