Property Summary

NCBI Gene PubMed Count 1,644
PubMed Score 860.00
PubTator Score 1412.50

Knowledge Summary

Patent

No data available

Gene RIF (1967)

PMID Text
27090234 Data show a combined role of cytochrome P 450 1A1 (CYP1A1), Glutathione -S -transferase M1 (GSTM1) and T1 (GSTT1) polymorphisms and smoking status can be attributed for the cause of lung cancer.
26970898 polymorphisms modified bromo-trihalomethane exposure relation to semen quality
26823865 we suggest that the GSTM1 null genotype and GSTT1 null genotype are correlated with an increased risk of gestational diabetes mellitus in a Chinese population.
26782535 No statistically significant association was found between GSTM1 or GSTT1 null genotypes and varicocele in the overall data analysis. (Meta-analysis)
26782376 The null or present polymorphism of GSTM1 and GSTT1 genes and Arg/Pro of the p53 gene were analyzed.
26663067 Data suggest that the combined genotypes of glutathionine S-transferase GSTM1 (-/-), GSTT1 (+/+), GSTP1 (AA) and meiotic recombination protein SPO11 (CT) may be associated with idiopathic male infertility in ethnic Han Chinese.
26656529 our meta-analysis suggests there is an association between GSTM1 and GSTT1 polymorphisms and RCC.
26604430 results show that GSTT1 null and MDR1 polymorphisms could play a role in susceptibility to inflammatory bowel disease
26580648 Effect of traditional healthy diet on reduced atopic dermatitis was significant or borderline significant in the GSTM1-present group or the GSTM1/T1 double present group. These associations did not exist in the animal foods and sweets dietary patterns.
26571237 individuals with GSTM1 null genotype and in combination with GSTT1 null and GSTP1 (AG+GG) have a survival advantage in cervical cancer patients
26552558 GSTT1-null genotype might be associated with the increased risk and enhanced susceptibility to oxidative stress in progressive myoclonus epilepsy patients
26548378 association between the combined GSTM1/GSTT1 double-null genotype and advanced liver fibrosis and outcome of chronic HCV infection in Egyptian patients
26529288 GSTT1 and GSTP1 polymorphisms did not show any significant association with lung cancer
26456689 Polymorphisms of maternal GSTT1, GSTM1, and GSTP1 may modify the association of maternal smoke exposure with congenital heart defects.
26435566 GSTT1 gene polymorphisms are not associated with susceptibility of developing diabetic neuropathy in T2DM patients.
26434855 In the present study, no risk of cervical cancer was observed in GSTT1 homozygous null genotype, except in smokers who showed a significant increased risk compared to nonsmokers.
26407578 When considered together, GSTM1 and GSTT1 genotypes were found to be associated with an increased risk of breast cancer. The relationship between GSTM1 and GSTT1 gene deletions and breast cancer risk was substantially altered by consumption of Smoked Meat/Vegetable
26406947 These results suggest that GSTM1 and GSTT1 deletion were associated with increased risk of colon and rectum cancer in Pakistani population.
26370772 This meta-analysis supports that the GSTM1/GSTT1 null genotype might contribute to individual susceptibility to endometriosis in Chinese populations, especially in Chinese Han. [Meta-Analysis]
26350109 The GSTT1 null genotype was more frequent in Brazilian women without endometriosis.
26345960 The current study aimed at evaluating the associa-tion between GSTM1 null/present, GSTT1 null/present, and GSTP1 IIe105Val polymorphisms and clinical response to chemotherapy and treatment outcome of breast cancers patients.
26327568 Association of GSTM1 and GSTT1 deletion polymorphisms with Pakistani aplastic anemia patients
26295386 Results revealed that GSTM1, GSTT1, and GSTP1 polymorphisms were not related to risk of schizophrenia, but based on ethnicity, GSTM1 polymorphism showed weak association with schizophrenia in East Asian population. [Meta-analysis]
26244436 the C-1562T SNP in the promoter region of the MMP-9 gene, the GSTT1 null, as well as the combined GSTM1 non-null and GSTT1 null genotypes are modulators of temporomandibular disorders risk in a Serbian population
26208492 This meta-analysis suggests that GSTT1 null polymorphism is associated with increased risk of posterior subcapsular cataract.
26186891 There were significantly higher levels of the GSTT1 null and the ACE II genotypes in ankylosing spondylitis patients compared to those in healthy controls
26179485 Null-GSTT1 and null-GSTM1 genotypes and Cytochrome P4502E1 (CYP2E1: rs2031920, rs3813867) may support the hematotoxicity of benzene-exposed workers in China, and we can make use of it to select susceptible population
26175060 AUthors performed genetic case-control CNV analyses to test for possible associations between schizophrenia and CNVs for the three genes GSTT1, DDTL, and GSTM1 in Japanese patients.
26163595 GSTT1 Polymorphisms are associated with Hepatic Carcinogenesis.
26158735 GSTT1 null genotype is a risk factor for patients with more primitive urologic malignancies.
26150166 Meta-analysis evaluating the associations between multiple sclerosis and polymorphisms of MTHFR, GSTM1, GSTT1, and GSTP1
26125851 No associations between the GSTT1, GSTP1, and GSTM3 genotypes and neoplasia risk were observed. In conclusion, we determined the genotype distribution of GST polymorphisms in control subjects and breast cancer patients from northeastern Mexico.
26125819 Results from genotypic profiling of the GSTT1-null polymorphism in Goiania showed no statistically significant difference in the prevalence of the null genotype between the case and control groups.
26046920 The GSTT1 present genotype was significantly associated only with a high risk of schizophrenia.
26003511 findings show the null genotypes of GSTM1 and GSTT1 were not associated with risk of heroin dependence(HD); null genotype of GSTT1 was significantly associated with opium dependence (OD); statistical analysis revealed the combination of "positive genotype of GSTM1/null genotype of GSTT1" significantly associated with either HD or OD
25923095 The combined genotypes of GSTM1 null, GSTT1 and GSTP1 105-Val allele were seen to have an increased risk of developing age-related cataract.
25880856 The GSTT1 null genotype was associated with significantly increased requirement of blood transfusion
25876999 Polymorphisms of GSTT1 and GSTM1 are associated with the methylation of arsenic.
25868597 Meta-analysis revealed slight increase of Parkinson's disease risk in GSTM1 null genotype in subgroup analysis of ethnicity, publication year and sample size of total cases; short of statistical significance was detected for GSTT1 null genotype
25867025 patternized null allele frequencies demonstrated in this study for the first time addresses the missing link in GST M1-T1 null allele frequencies among GAHPs
25799091 GSTM1-null genotype was associated with a lower risk of developing acute childhood leukemia, while GSTP1-GG variants displayed an increased risk, and no differences were found for GSTT1 gene.
25790712 Children with the neutrophilic phenotype of bronchial asthma having deletions in the GSTT1/GSTM1 system are characterized by bronchial hypersensitivity to histamine and dosed physical exercises.
25775823 Polymorphic variants of GSTP1,GSTM1,GSTP1, and NAT2 genes were accociated with development of occupational lung cancer.
25773389 we investigated the relationship between the clinical outcome and the GSTM1 null/present, GSTT1 null/present, and GSTP1 IIe105Val polymorphisms in breast cancer patients with chemotherapy.
25735346 GSTT1 gene variants are associated with the risk of developing oral cancer in tobacco addicted patients.
25724184 Smokers carrying CYP1A1 TC/CC + GSTM1 null and CYP1A1 TC/CC + GSTT1 null genotypes showed significant association with head and neck cancer risk
25697264 Its genotype in cervical cell samples may be associated with more severe precancerous lesions of the cervix in a Japanese population.
25663492 no significant difference was observed in the null genotype of GSTT1 among squamous cell carcinoma of cervix patients
25654087 The aim of the study was to assess whether selected single nucleotide polymorphisms of CYP1A1 and 2E1, GSTM1, GSTT1, and SULT1A1 influence susceptibility towards hepatocellular carcinoma.
25646594 among anesthetists, GSTT1 null individuals showed a significant higher frequency of SCE with respect to GSTT1-positive subjects.
25628002 The null polymorphism of the GSTM1 or GSTT1 genes is not associated with susceptibility to systemic lupus erythematosus. (Meta-analysis)
25549292 gene deficiency predisposes to endometriosis in a Tunisian population
25532576 The effect of GSTM1 and/or GSTT1 (especially the former) is underrated in modulating the risk of male infertility in males from Sichuan, Southwest China.
25525805 Results did not support the GSTM1 and GSTT1 polymorphisms as the predictors of anti-tuberculosis drug induced hepatotoxicity in Chinese Han children treated with anti-tuberculosis drugs.
25472599 oxidative damage may be play a important role in patients with N-SCLC, and that GSTM1 and glutathione S-transferase M1 and T1 genes genotypes may predispose the cells of patients with non-small lung cancer to increased oxidative damage
25461363 Meta-analysis provides strong evidence that the GSTM1 and GSTT1 polymorphisms are associated with the development of endometriosis.
25445355 STin2, GSTM1, and GSTT1 polymorphisms, and PON1 status would be associated with comorbid tobacco use + mood disorders.
25432134 We found a significant interaction between the GSTT1 and GSTM1 genotypes with regard to esophageal squamous cell carcinoma risk (P = 0.001); however, there were no interactions between environmental factors and GSTT1 and GSTM1 genotypes
25420021 Data show there were combined effects of glutathione S-transferase GSTM1 and GSTT1 genotypes and fruit & vegetable intake on cognitive function in the elderly population.
25408579 The GSTT1 non-null and GSTM1 null combination resulted in a significantly decreased colorectal cancer risk.
25378345 A meta-analysis to determine the association between chronic pancreatitis and glutathione-S transferase (GST) mu 1 (GSTM1) and theta 1 (GSTT1) deletions.
25375048 The research on GSTT1 protein, human consisted in patients diagnosed with multiple breast cancers.
25366778 Data indicate that the combined glutathione S-transferases GSTM1 null and GSTT1-present genotypes were more frequent in the primary open-angle glaucoma group compared to the control group.
25358668 The present study supports the hypothesis that impairment in the promoter region of GSTT and GSTP genes by hypermethylation may increase the risk of schizophrenia
25357227 It is concluded that ACE (rs 4646994), FABP2 (rs1799883) and GST (GSTM1 null or positive genotype and GSTT1 null or positive genotype) genes polymorphism are associated with essential hypertension.
25348056 GSTM1, GSTT1 and GSTP1 genes are collectively involved in the development of idiopathic male infertility and their phenotypic effects on the disease risk are potentiated by cigarette smoking.
25341249 Polymorphism of studied GST genes (GSTM1,GSTT1 and GSTP1) and various combinations of polymorphic variants did not affect the risk of BPD developing
25305053 Maternal null GSTM1 was associated with a 144 g (95% CI, -291, 1) and combined maternal/infant null GSTT1 was associated with a 155 g (95% CI, -303, -8) decrease in birth weight
25263840 Exposure to high levels of perinatal anxiety affected the development of respiratory tract infections in infants, especially bronchiolitis, depending on the polymorphisms of genes such as glutathione S-transferase P1 and glutathione S-transferase T1.
25251951 The distribution of genotype frequencies for GSTM1, GSTT1, and GSTP1 I105V polymorphisms were not associated with risk of prostate cancer in the study sample
25208225 null genotypes of GSTM1 and/or GSTT1 contribute to risk of endometriosis
25198353 Copy number variation of GSTT1 and GSTM1 and the risk of prostate cancer in a Caribbean population of African descent
25186055 An increased risk for ulcerative colitis in individuals with the GSTT1 null genotype was shown in meta-analysis.
25102096 Studies indicate that glutathione S-transferases GSTM1 and GSTT1 null genotypes were associated with increased risk of childhood acute lymphoblastic leukemia (ALL), which was not associated with GSTP1 genotype.
25101770 Using log-transformed whole blood arsenic concentrations as the dependent variable in a General Linear Model, there was a significant interaction between GSTP1 and autism spectrum disorder case status, but not for GSTT1 and GSTM1.
25086621 Null genotype of GSTT1 contributes to increased Parkinson's disease risk in Caucasians: evidence from a meta-analysis.
25040976 To identify the genotypes of CYP1A1, GSTM1, GSTM3, GSTT1 and GSTP1 in a case-control study.
25036724 associations between two vital GSTs genetic polymorphisms and lung cancer risk in the Chinese population
25027082 The results suggest that absence of GSTT1 null genotype may be associated with a reduced risk of lung cancer and the effect remains unchanged after interaction with smoking
25015263 study of risk association of GST M1 and GST T1 genotypes with head and neck cancer in tobacco users in India
25010410 null genotype associated with female infertility, though not significantly
24994605 The GSTT1 null genotype was associated with a reduced response after first course of induction chemotherapy, progression-free survival and overall survival in AML. Review.
24970787 No significant effects were observed between individuals with GSTT1 null genotype and epilepsy risk.
24915237 Air pollution exposure entails an increased risk of acute myocardial infarction, and this risk differed over genotype strata for variants in the GSTP1, GSTT1 and GSTCD genes, albeit not statistically-significantly.
24914957 The role of the glutathione S-transferase A1, M1, P1 and T1 gene polymorphisms and potential effect modification by occupational exposure to different chemicals in Serbian bladder cancer male patients, was investigated.
24913811 Chronic myeloid leukemia patients carrying the GSTT1 present/GSTM1 present genotype are less resonsive to imatinib and the interaction between GSTT1 and GSTM1 seems to influence treatment outcome.
24908960 In patients with neutrophilic bronchial asthma and polymorphism of genes GSTT1 and GSTM1 there was a tendency to decreasing the bronchial lability index through the decreased bronchodilation.
24907267 meta-analysis associates GSTT1 null genotype with prostate cancer risk in Caucasians, but not overall population
24879623 Studies suggest that glutathione S-transferase T1 (GSTT1) null genotype is associated with laryngeal cancer risk in Asians.
24854448 These findings indicate that genetic variants of GSTTI and GSTM1 significantly increase the risk of developing AML. Our study offers important insights into the molecular etiology of AML.
24852428 suggests that there would be no direct interaction of GSTM1 and GSTT1 genotype in hepatocellular carcinoma risk
24845160 Maternal genetic susceptibility GSTT1 and PON2 rs12026 could significantly modify the association of organic solvents with gestational age.
24840051 Report GSTT1 genetic polymorphisms in Egyptian pediatric patients with sickle cell disease.
24818511 Association of homozygous GSTT1 gene deletion with predisposition to lung cancer was detected in residents of Belarus.
24815471 GSTT1 null genotype or different genotype combinations were not found to be risk factors, irrespective to lesion stages, age or smoking.
24809844 role of GSTT1 and GSTM1 polymorphism in COPD with special reference to peoples living in the vicinity of the open cast coal mine of Assam
24788870 GSTT1 null genotypes are associated with the risk of developing essential hypertension.
24754249 The present study suggested that GSTM1, GSTT1 and FTO gene polymorphisms are associated with increased risk for cataract in North Indian populations.
24732639 Polymorphisms in GSTT1 and GSTM1 are associated with the risk of lung cancer in a gender-specific manner.
24716977 GSTT1 mRNA levels among different grades increased gradually.
24716937 Positive associations between GST polymorphisms (GSTM1 and GSTT1 but not GSTP1) and acute leukemia risk.
24685594 GSTM1-null and GSTT1-null genotypes were found to be independent risk factors for the development of sential arterial hypertension in Slovenian patients with type 2 diabetes.
24671854 GSTT1 polymorphisms are associated with chronic myeloid leukemia.
24670356 In older males, the GSTT1 null genotype was not associated with COPD disease susceptibility.
24640692 the combination of allelic GSTM1 "+"/GSTT1 "+" variants was significantly higher in long livers compared to the control group
24637631 This study suggests that at least one deletion of the GSTM1 and GSTT1 genes represents a risk factor for anxious smokers.
24637014 Results show that double null genotype in GSTT1 is associated with antitubercular agent hepatotoxicity.
24605635 Polymorphism of GSTM1 and GSTT1 genes is associated with development and severity of asthma in children.
24586676 GSTT1 deletion is related to polycyclic aromatic hydrocarbons-induced DNA damage and lymphoma progression.
24582550 no significant association between null mutation and advanced pelvic organ prolapse
24562622 Our study suggests that the GSTT1 null genotype is associated with a significant increase in gastric cancer risk in Caucasians, but not in Asians.
24559168 The significant detection of GSTT1 null genotype more in controls than in asthmatics with no association with other atopic manifestations or asthma severity and the lack of association detected between GSTM1 polymorphism in relation to asthma.
24535908 The presence of polymorphic forms of GSTP1, GSTM1, and GSTT1 was crucial to conferring better OS and DFS among women with negative axillary lymph nodes.
24535898 Polymorphisms in the GSTT1 and GSTM1 genes are associated with increased risk of preeclampsia in the Mexican mestizo population.
24535881 GSTT1 polymorphisms may confer a substantial risk to upper aerodigestive tract cancers.
24535271 These findings suggest that polymorphisms of the MTHFR C677T, GSTM1 and GSTT1 genotypes do not contribute to the development of PTC susceptibility in the Korean population.
24532428 meta-analysis does not provide a strong evidence for causal associations between GSTM1 and GSTT1 polymorphisms and risk of ovarian cancer in Caucasians
24528063 Our results indicate no overall association between the GSTM1 and GSTT1 deletion polymorphisms and pancreatic cancer risk in the Japanese subjects in our study.
24527777 novel multiplex PCR method of GSTM1, GSTT1, and GSTP1 polymorphisms is simple, fast, low-cost, and reliable for the simultaneous detection of GSTM1, GSTT1, and GSTP1 Ile105Val polymorphisms.
24508281 Our results suggest that the GSTM1non-null, GSTT1null, and CYP1A1*2A genotypes may be good prognosis markers in patients with prostate cancer
24500512 The frequency of null alleles for GSTM1 and GSTT1 was 58.8 and 61.7%, respectively, for patients with breast cancer, and 41.2 and 38.3%, respectively, in control patients
24460278 GSTT1 deletion polymorphism does not have a significant effect on the susceptibility to lung cancer.
24460270 GSTT1 null genotypes are risk factors for lung cancer.
24453034 work aimed to evaluate single nucleotide polymorphisms (SNPs) of IFNGR1, GSTT1, and GSTP1 genes samples in gastric cancer
24411789 GSTT1 polymorphisms is associated with BCG therapy failure in patients with non-muscle invasive bladder cancer.
24407598 A multiplex polymerase chain reaction (PCR) method was used to detect the deletions in GSTM1 and GSTT1 genes in the genomic DNA in 346 atherosclerosis patients and 330 controls
24382428 The results of this meta-analysis suggest that GSTT1 polymorphism is not a Parkinson disease risk factorin in Caucasians.
24381101 The frequency distribution for single, double and triple combinations of genotypes of GSTT1, GSTM1 and GSTP1 showed the varying degrees of association with Diabetes mellitus type 2
24375038 GSTT1 polymorphisms are not associated with gastric cancer in a small group of the Turkish population
24352702 the GSTT1 null genotype is associated with an increased gastric carcinoma risk in the overall population, Caucasians, East-Asians, and Chinese.
24337975 summarized odds ratio for RCC of the GSTM1 null and GSTT1 null polymorphisms was 1.02 (95% confidence interval (CI) 0.91-1.15, P = 0.70) and 1.28 (95% CI 0.96-1.72, P = 0.09), respectively
24326830 GSTT1 appears to influence lung cancer survival whereas GSTM1 seems to have no effect.
24319713 Association of GSTT1 and GSTM1 polymorphisms and chronic mercury intoxication.
24295891 GSTM1/T1 null polymorphisms may be associated with vitiligo
24291050 These results demonstrate significant associations between low activity GST genotypes and proatherogenic lipoprotein particles in hemodialysis patients which might further increase their cardiovascular disease risk.
24282086 the GSTT1 null variant is significantly associated with susceptibility to childhood acute lymphoblastic leukemia in Asians.
24254297 There was no association between GSTM1 and GSTT1 genotypes and colorectal cancer risk
24250808 These findings indicate that GSTM1 and GSTT1 polymorphisms may play critical roles in the development of cancer, especially in smokers.
24216264 organochlorine pesticides level in chronic kidney disease patients is partially dependent on GSTM1/GSTT1 polymorphism and particularly GSTM1(-)/GSTT1(-) genotype is more vulnerable in this regard
24203463 GSTT1, GSTM1 and GSTP1 gene polymorphisms were analysed in 321 type 2 diabetes mellitus patients and 309 healthy controls from an endogamous population from north India.
24189890 GSTT1 null genotype is associated with the lung cancer in overall populations and in Asians.
24124608 Extracellular Spaces/METAB GSTT1 copy number gain and ZNF overexpression are predictors of poor response to imatinib in gastrointestinal stromal tumors.
24122206 Our results suggest that GSTT1 null genotype was not associated with the increased risk of glioma
24120392 The results suggest that null genotypes of GSTM1 and GSTT1 genes may contribute to the development of BPD in our Chinese Han population
24114827 Report GSTM1 null and combined GSTM1 and T1 null genotypes to be risk factors of anti-TB drug-induced hepatotoxicity in Western Indian population.
24098457 the GSTT1 polymorphism may play an important role in the pathogenesis of T2DM in the Brazilian population.
24086370 this is the first meta-analysis evaluating the relationship of polymorphisms and hypermethylation in GSTs and biochemical recurrence.
24075358 Data indicate that genotypes of the GSTA1, GSTM1, GSTT1, and GSTP1 did not contribute independently towards the risk of bladder cancer, but in association with smoking, both GSTA1 and GSTM1 increase individual susceptibility to bladder cancer.
24072652 GSTT1 null genotype is associated with the lung cancer in overall populations and in Asians.
24053064 The study indicates that GST T1 null genotype and GST T1 null/M1 wild combination could be considered a risk factor for type 1 diabetes development in Slovak children
24040330 GSTT1 active genotype and GSTO1 Asp140Asp and GSTO2 Asp142Asp genotypes may have a prognostic/pharmacogenomic role in patients with muscle invasive bladder cancer.
24008019 Significant association has been found between GSTT1 polymorphism and type 2 diabetes mellitus. (Meta-analysis)
23982010 This study suggests the association between Parkinson disease and previous pesticide exposure, the effects of which seem to be enhanced when combined with the nullity for GSTT1/GSTM1.
23979980 GSTT1 null polymorphism is associated with elevated GC risk, but these associations vary in different ethnic populations.
23975364 GSTT1 null allele is associated with increased risk of gastric cancer.
23959468 the GSTT1 null genotype contributes to an increased risk of HCC in East Asians and that interaction between unfavorable GSTs genotypes may exist.
23949879 GSTT1 null genotype is significantly associated with increased risk of nasopharyngeal carcinoma in Chinese.
23949201 Data indicate that genetic polymorphisms of aflatoxin B1 (AFB1) metabolic enzymes CYP2E1, EPHX1, GSTM1, and GSTT1 were not associated with gastric cancer, with the exception of CYP1A2.
23932298 study suggests the potential pathogenic role of GSTT1 deletion, and double deletion (GSTM1 null/GSTT1 null) on the MS susceptibility.
23888321 the GSTM1 gene polymorphism contributes to PCa susceptibility, while GSTT1 gene polymorphism is not associated with PCa in our study.
23886208 Specific combination of GSTM1 null, GSTT1 null, and CYP1B1 codon 119 risk allele carriers exhibited increased bladder cancer risk.
23886197 GSTT1 polymorphisms are associated with acute myeloid leukemia.
23886141 Genetic deletions of GSTT1 is associated with head and neck cancer.
23877133 Our case-control study showed the GSTM1 null genotype was significantly associated with idiopathic oligozoospermia, while the null genotype of GSTT1 was significantly associated with normozoospermia and azoospermia.
23873097 Homozygous deletion of the GSTT1 gene in women of the West Siberian region is a risk factor for birth defects in the child.
23810248 Data indicate that the GSTM1-null genotype plays an important role in genetic susceptibility to muscle invasive bladder cancer (MIBC) and the GSTT1-null genotype is associated with disease progression and shorter survival in MIBC.
23798465 The association between AA and GSTT1 deletion suggests a role of glutathione-conjugation in AA, possibly through protecting the hematopoietic compartment from endogenous metabolites or environmental exposures.
23794132 Studies suggest that the present/null polymorphism in the GSTT1 gene might contribute to the risk of lung cancer in Chinese population.
23790786 The study evaluates genetic polymorphisms of three glutathione S-transferases (GSTM1, GSTT1and GSTP1) in patients with synchronous malignant colorectal tumors.
23773486 This meta-analysis suggests that the GSTT1 null genotype may contribute to increased risk of colorectal cancer.
23767447 risk of developing a disease when exposed to PCB. Polymorphism in the area of GSTTl gene (GSTT1 null) could be a potential genetic risk marker
23765968 A study of a Brazilian population with malignant glioma to determine whether GSTM1 and GSTT1 genetic polymorphisms influence the response to intranasal administration of perillyl alcohol and the survival rate, is reported.
23758905 Polymorphisms in GCLC, GSTM1, GSTT1, and GSTP1 genes associated with metabolism of glutathione act on cystic fibrosis severity.
23749488 GSTT1 and GSTM1 polymorphisms correlate with susceptibility to esophageal neoplasms in different Indian populations.
23747403 meta-analysis suggested that GSTM1 null genotypes are associated with increased primary open-angle glaucoma (POAG) risk in Asian populations but not Caucasian and mixed populations; dual null genotype of GSTM1/GSTT1 is associated with increased risk of POAG
23731957 GSTT1 was not associated with esophageal adenocarcinoma or esophageal squamous cell carcinoma susceptibility in Caucasians.
23725116 Deletion of GSTT1 gene is associated with the development of acute lymphocytic leukemia and acute myeloid leukemia.
23720024 GSTT1 null genotype have a modest effect on the genetic susceptibility to pancreatic cancer, and GSTT1 null genotype is associated with increased risk of pancreatic cancer.
23717494 The GSTM1, GSTT1 and GSTP1 polymorphisms are not associated with the development of RCC.
23696026 Meta-analysis suggests the GSTT1 null genotype is significantly associated with an increased risk of myelodysplastic syndromes in both Caucasians and Asians. [Meta-analysis]
23690164 The presence of GSTT1-null genotype did not influence urinary sodium excretion (USE) or affect the interactions between USE and blood pressure.
23679259 GSTT1 null genotypes are associated with an increased risk of nasopharyngeal cancer.
23661016 GSTT1 null genotype can modulate the risk for head and neck cancer.
23637998 These meta-analysis results suggest that GSTT1 null genotype is associated with a significantly increased risk of lung cancer in Asian population.
23631429 These results indicated that the null genotype of the GSTM1 gene might contribute to the susceptibility of male infertility, whereas the null genotype of the GSTT1 gene may be a genetic susceptibility factor of male infertility for the Chinese.
23628324 Polymorphisms of GSTT1 were not associated with breast cancer risk in a case-control study of Lebanese women.
23609031 Glutathione S-transferase T1 null genotype is associated with oral cancer susceptibility.
23600494 This meta-analysis provides evidence that GSTM1 and GSTT1 polymorphisms may be risk factors for asthma.
23590899 The absence of GSTT1 and/or GSTM1 was an important risk factor for increasing the morbidity of SCA, especially in regard to acute chest syndrome.
23589999 GSTT1, GSTM1, and GSTP1 polymorphisms are not associated with endometrial cancer in the Caucasian population.
23585855 There is significant association between GSTT1 null genotype and increased risk of gastric cancer. (Meta-analysis)
23570881 The GST genetic variants examined were not associated with susceptibility to coronary artery disease in our Taiwanese cohort.
23552977 the association of genetic polymorphisms in GSTM1, GSTT1, GSTP1, and those involved in DNA damage repair, OGG1 and XRCC1, in an Italian cohort of sporadic Parkinson's disease patients, was studied.
23512328 GSTT1 null genotype contributes to increased risk of gastric cancer.
23484121 in men with blood lead >6.47 mu g/dL the adjusted odds ratio (OR) of CRP levels for individuals with GSTP1 variants allele, GSTM1 null, GSTT1 null, double-null GSTM1, and GSTT1 compared with wild-type allele.
23469236 Strong association has been found between HPV infection, GSTM1-GSTT1 null genotypes, mtDNA content, and the development of oral squamous cell carcinoma.
23464442 The frequency of homozygous null type of GSTT1 was significantly higher.
23456766 GSTT1 polymorphism is not associated with prostate cancer.
23450492 The M1(-/-) and P1(Ile/Val or Val/Val) genotype and the M1(-/-), T1(+/+) and P1 (Ile/Val or Val/Val) genotype are associated with reduced risk of azoospermia in ethnic Chinese Han population.
23444902 The association of glutathione S-transferase gene mutations (including GSTT1 and GSTM1) with the prognostic factors and relapse in acute lymphoblastic leukemia.
23444898 The oral cancer risk was significantly increased in the patients having either alone or concurrent deletion of GSTM1 and GSTT1
23437305 Our results indicate that both GSTM1 and GSTT1 null genotypes are associated with an increased HCC risk in Chinese population. Peoples with dual null genotypes of GSTM1-GSTT1 are more susceptible to developing HCC.
23433732 GSTT1 and GSTM1 polymorphisms are genetic risk factors for pregnancy loss in an Indian study population.
23397542 glutathione S-transferase T1 contributes to increased risk of gastric cancer
23377313 meta-analysis provides evidence that polymorphisms of the GSTT1 null genotype seem to have no association with susceptibility to anti-tuberculosis drug-induced hepatotoxicity, except for patients receiving HRZ
23376175 GSTM1 and GSTT1 were significantly linked with the risk of breast cancer in smokers and in Pakistani women with a history of breast cancer in the family
23365641 The GSTT1 null genotype is associated with prostate cancer susceptibility, and the GSTT1 null genotype contributes to increased risk of prostate cancer.
23343819 the GSTT1 null genotype is significantly associated with an increased risk of PCa in Caucasians [meta-analysis]
23342067 GSTT1 null polymorphism was not associated with a POAG risk, and this negative association maintained in Caucasian.
23330093 relationship between blood levels of HSP70 and HSP90 and genotypes of HSP70, GSTT1, and GSTM1 polymorphic variants in individuals chronically exposed to mercury; combination of GSTT1(+)/GSTM1(0/0) genotypes was associated with reduction of protein levels; variants including GSTT1(0/0) were associated with a significant elevation
23317232 The frequency of GSTT1 homozygous null genotypes is also significantly higher in blacks and Asians.
23311983 Null genotypes of GSTM1 and GSTT1 are associated with spermatogenesis impairment and may contribute to spermatogenesis impairment and male infertility in the Chinese population.
23296061 null genotypes of GSTM1/GSTT1 and dual null genotype of GSTM1-GSTT1 are all associated with increased risk of diabetes mellitus, and null genotypes of GSTM1/GSTT1 and dual null genotype of GSTM1-GSTT1 are potential biomarkers of diabetes mellitus
23293967 Genotype frequencies of GSTT1 genes did not vary in both exposed to vehicle emission and control groups.
23275251 GSTT1 polymorphism is associated with nasopharyngeal cancer.
23275234 Our results showed that individuals with the null genotypes for GSTM1 had protective effect, while GSTT1 was at a higher risk for Myocardial infarction .
23274376 results suggested that GSTT1 wild genotype and C-allele of megalin gene rs2228171 SNPs might be risk factors for cisplatin-induced ototoxicity
23268570 The findings suggested a birthweight reduction among light-smoking mothers with the GSTT1-null genotype. When combined with GSTM1-null genotype, the birthweight reduction was significant in light-smoking mothers.
23265943 A significant association was found between the numbers of D-loop mutation and GSTM1, GSTT1 null genotypes respectively in oral squamous cell carcinoma
23244092 Null genotype of GSTT1 contributes to esophageal cancer risk.
23239128 GSTT1 gene polymorphisms are not associated with male infertility.
23238917 GSTM1 null genotype contributes to increased risk of male idiopathic infertility in Caucasians, and males with dual null genotype of GSTM1/GSTT1 are particularly susceptible to developing idiopathic infertility.
23238916 GSTT1 null genotype is independently associated with increased risk of esophageal cancer, and a race-specific effect may exist in this association.
23232001 The GSTT1 null genotype or GSTM1/GSTT1 interaction may not affect susceptibility to ATDILI
23227845 GSTM1 and GSTP1, but not GSTT1 genetic polymorphisms are associated with increased risk of breast cancer in our population
23222181 The prevalence of GSTT1-0 genotype was 16.4%, while GSTM1-0 was 48.7%. Among Lithuanian mothers who delivered low birth weight infants, the prevalence of GSTT1-0 genotype was higher compared to controls (20.3% vs. 16.4%, respectively).
23215883 Our results show that GST-M1 and GST-T1 homozygous deletions have opposite correlation with relapse, the former being protective and the latter unfavourable in specific subsets of acute lymphoblastic leukemia patients
23189206 people with GSTM1 null genotype, with dual null genotype of GSTM1 and GSTT1, or with GSTT1 null genotype and GSTP1 A131G polymorphism are associated with high risks of PCa.
23185284 This meta-analysis suggests that the GSTM1 and GSTT1 null genotype may slightly increase the risk of hepatocellular carcinoma.
23184765 GSTT1 null polymorphism is associated with risks of pancreatic cancer.
23173169 genetic association studies in population in South Korea: Data provided no evidence that genetic polymorphism in GSTT1 (i.e., gene deletion) could determine whether maternal dietary iron during pregnancy influences birth weight and oxidative stress.
23167410 Polymorphisms of GSTM1 and GSTT1 genes were not found to be directly associated with stomach cancer in Mizoram. However, they appeared to be effect modifiers.
23167353 The GSTT1 null genotype is associated with HCC susceptibility in Chinese.
23167350 This meta-analysis suggests a significant association of GSTT1 null genotype with esophageal cancer risk in the Chinese Han population.
23164539 There was evidence that the null of GSTM1 and GSTM1-GSTM1 increased the risk of male factor infertility, but the null genotype of GSTT1 was not associated with an increased infertility risk.
23159492 results suggest higher levels of 1,3-Butadiene (BD) exposure in the workplace resulted in increased chromosomal damage, and that polymorphisms in GSTT1 and GSTM1 genes might modulate the genotoxic effects of BD exposure; the GSTT1 and GSTM1 polymorphisms exhibited an additive effect
23153768 no association of recipient genotype with acute cellular rejection incidence in living donor liver transplantation
23152866 The combined genotypes of CYP1A1 and GSTs can help to identify vulnerable pregnant women who are subject to high risk of spontaneous preterm delivery due to passive smoking.
23146971 We did not find significant associations for GSTT1 and GSTM1 genotypes and prostate cancer biochemical relapse after prostatectomy
23107768 the combination of the GSTM1 and GSTT1 null genotypes showed a non-significant trend to an increased risk of schizophrenia.
23077643 this meta-analysis presented additional evidence of the association between GSTM1 and GSTT1 polymorphisms and head and neck squamous cell carcinoma risk
23076538 A significant association between GSTT1 null genotype and risk of asthma during childhood in Caucasians. [Meta-analysis]
23026209 subgroup analysis on ethnicity showed no notable association between the polymorphism and the risk of idiopathic male infertility in any of GSTM1 null and GSTT1 null genotype
23021798 GST T1 wild allele and GST T1/M1 wild/null genotype can be considered as risk factors for cardiovascular autonomic neuropathy in Slovak adolescents with T1 diabetes.
23019974 Deletion polymorphism of GSTT1 glutathione transferase gene is recommended as a marker for predictive diagnostics of development and progress of chronic obstructive pulmonary disease.
23014993 GSTM1 and GSTT1 genotypes might be involved in the pathogenesis of type II diabetes mellitus in south Iranian population.
23013535 Results suggest that genetic polymorphisms in the CYP1A1, GSTM1, GSTT1 and GSTP1 metabolic genes were not significantly associated with lung cancer risk.
22994755 GSTT1 null genotypes are associated with increased risk of gastric cancer, and smoking modifies the association.
22965834 Presbycusis subjects with mutant alleles for GSTT1 were more likely to have a HFSS audiogram than subjects with the wild type genotype, suggesting that the basal turn of the cochlea is susceptible to GSTT1 regulated oxidative stress.
22960333 GSTT1 polymorphisms associate with epithelial ovarian cancer risk.
22952149 The GSTM1, GSTT1, and GSTP1 gene polymorphisms evaluated in this study are not relevant when determining the individual susceptibility to GC or phenotype in a South-European population.
22938433 meta-analysis of available data suggested the GSTT1 null genotype does contribute to increased risk of prostate cancer in Asians
22918668 Carcinogen detoxifying genes may be involved in pathogenesis of head and neck cancer. Immunohistochemistry data showed that CYP1A1 and GSTT1 was down expressed whereas GSTP1 was over expressed in HNC tissues compared with adjacent normal control tissues.
22905990 Our results suggest that the GSTT1 gene polymorphism may influence the baseline cytogenetic frequency in a healthy Turkish population.
22903474 These results demonstrated that amongst populations studied to date, GSTM1 and GSTT1 null genotypes are associated with strong and modest increase in the risk of male infertility, respectively.
22893352 Report possible associations between GSTT1 gene polymorphism and the risk of lung cancer.
22885711 Investigate whether the genetic polymorphisma GSTP1, GSTM1, GSTT1 are associated with susceptibility to noise-induced hearing loss. Results suggest that GSTM1, but not GSTT1 or GSTP1 is associated with susceptibility to noise-induced hearing loss
22880812 study results suggest that GSTT1 null genotype is associated with the RCC susceptibility in Caucasians and Asians, and the dual null genotype of GSTM1-GSTT1 is associated with RCC risk in Asians [meta-analysis]
22874804 The NULL genotype for GSTT1 increases the risk of schizophrenia in a sample of an Iranian population.
22858312 polymorphic deletions of glutathione S-transferases T1 might be a genetic risk factor for myocardial infarction in patients with type 2 diabetes mellitus
22852846 These data suggest that GST polymorphisms may be associated with methylmercury detoxification.
22845549 GSTM1 and GSTT1 null genotypes do not seem to play important roles in anti-tuberculosis drug-induced liver injury in Brazilians
22841242 Risk of acute graft rejection is higher for anti-GSTT1 antibody-positive kidney translant recipients.
22813660 GSTT1 deletions are associated with late onset Alzheimer's disease in North Indian cohort.
22812193 no association between gene polymorphisms and asthma in adult patients from Rome, central Italy
22799358 This study reported the carriage of null GSTT1 and null GSTM1 might be linked to the higher death risk from gastric cancer in Chinese population.
22788240 Polymorphisms in the NAT2, GSTM1, GSTT1, and CYP2E1 genes were found to have an increased risk of adverse drug reactions , as revealed by gene-gene interaction analysis.
22782090 There was a statistically significant association between the combined GSTM1 and GSTT1 null genotypes (M-/T-) and mammographic density in post menopausal women
22766250 Several manifestations of Behcet's disease may be influenced by smoking, and this effect can be augmented in patients carrying GST gene polymorphisms.
22752755 CYP1A1 m1 and m2 genotypes singly act as protective factors but in the absence of GSTM1 and/or GSTT1 gene significantly alters risk towards oral submucous fibrosis.
22736250 No role was found for GSTM1 and GSTT1 polymorphisms in oxidative stress induced in the workers of natural gas refineries.
22734843 the GSTT1 null genotype appears to be associated with a modest increase in the risk of NHL, whereas the GSTM1 and GSTP1 Ile105Val polymorphisms are unrelated to lymphoma risk.
22732554 The study evaluated associations between air pollutants and markers of insulin resistance (IR), and effect modification by glutathione S-tranferase mu 1, theta 1, and p1 genotypes (GSTM1, GSTT1, and GSTP1) in a Korean elderly environmental panel study.
22729902 Meta-analyses of available data suggest the GSTT1 null genotype contributes to increased risk of CHD in Caucasians.
22724567 early onset of cisplatin induced hearing impairment with absence of null allele of GSTT1
22697302 Variability in GST genes (GSTA1, GSTT1, GSTP1, GSTA1) is not a major determinant of colorectal cancer susceptibility in the Central European population.
22692893 Null genotypes of either GSTT1 or glutathione S-transferase glutathione S-transferase mu-1 (GSTM1) do not affect benign prostatic hyperplasia risk; however, double deletion of both genes is significantly associated with benign prostatic hyperplasia.
22686321 The frequency of GSTT1 negative genotype in osteoarthritis cases and controls was normal
22681588 Analysis of the combined effect of GSTM1 and GSTT1 polymorphism (using GSTM1+/GSTT1+ as reference) found a significant association of vitiligo risk with the GSTT1/GSTM1 double-null type only
22665971 The GSTM1 positive genotype and a combination of GSTM1 positive and GSTT1 null genotypes may be associated with a susceptibility to age-related cortical cataract in the Han Chinese population.
22664944 The CYP1A1*2A (T/C, C/C), mEPHX*3 (His/His), GSTM1 (null), GSTT1 (null) and XRCC1 399 (Arg/Gln, Gln/Gln) alleles correlate with an increased predisposition to ulcerative colitis.
22653598 It was concluded that early ageing is under the influence of GSTM1 and GSTT1 and the environmental and socio-demographic factors.
22652274 the combined evaluation of GSTM1-GSTT1-GSTP1 and OGG1 Ser326Cys gene polymorphisms can be used as candidate genes in the etiology of T2DM, especially in the development of T2DM.
22631654 meta-analysis provided strong evidence that the GSTM1 genotype is associated with the development of cervical cancer, especially in smokers, and Chinese and Indian populations; no association was found for GSTT1 null genotype carriers
22539183 In comparison with European and Asian populations, Afghanistan populations like Iranian populations showed intermediate frequency for the GSTT1 null genotype.
22537952 GSTT1 and GSTM1 might play a potential role in the pathogenesis of both infectious mononucleosis and acute lymphocytic leukemia.
22528457 The present study is the first to show the association of null genotype of the GSTT1 gene with increased risk of cerebral stroke.
22510168 Review/Meta-analysis: GSTT1 null polymorphism may increase the risk of rheumatoid arthritis in relation to heavy smokers or seropositive results.
22502716 Polymorphic variation in GSTT1 gene was associated with chronic myeloid leukaemia.
22502694 Polymorphic variation in GSTT1 gene was not associated with brain tumor.
22502660 Polymorphic variation in GSTT1 gene was not associated with gliomas.
22484853 Data indicate that GSTT1 null genotype conferred almost fourfold increased risk of diffuse large B-cell lymphoma (DLBCL), while GSTM1 null genotype was not associated with DLBCL risk.
22484660 It was shown genetic polymorphisms as a result of deletions in the GSTT1 and GSTM1 genes confer an increased risk towards asthma.
22475179 Polymorphisms in genes encoding interleukin-10 and drug metabolizing enzymes GSTP1, GSTT1, GSTA1 and UGT1A1 influence risk and outcome in Hodgkin lymphoma.
22471491 Polymorphisms in GSTT1 gene is associated with gastric cancer.
22471480 Polymorphisms in GSTT1 gene is associated with osteosarcoma.
22446016 The data suggests that GSTM1 positive, GSTT1 null and double null (GSTM1 null and GSTT1 null) genotypes may confer risk for the development of age related cataracts.
22407040 When the patients were stratified by clinical and epidemiological features, the frequencies of the GSTM1 and GSTT1 null genotypes were similar, suggesting that the inherited absence of these enzymatic pathways does not alter the course of CF.
22393996 Our study provides evidence that genetic deletion of GSTM1 and GSTT1 may contribute to increased susceptibility to nasopharyngeal cancer in Chinese population, while GSTP1 may not.
22392686 decreased activity of GSTM1/GSTT1 enzymes elevates lung cancer risk in male smokers, likely due to impaired carcinogens detoxification
22383780 genetic association studies in a population of men in north India: Data suggest that risk of male infertility is lowered by the combined effects of the null genotypes of GSTT1 (glutathione S-transferase T1) and GSTM1 (glutathione S-transferase M1).
22377702 Individuals homozygous for the deletion of GSTT1 are at a 2-fold-greater risk of diabetic retinopathy (DR), whereas the GSTM1 deficiency is associated with lower frequency of DR in type 2 diabetics.
22339266 a strong association was observed between the combination of GSTT1 null and GSTM1 null genotype and risk of bladder cancer
22335459 There was no statistically significant association between GSTM1/GSTT1 null genotypes and ATDH.
22330623 GSTT1-0 genotype and GSTT1-0/GSTM1-0 haplotype might be a potential determinants of susceptibility to advanced atherosclerosis in patients with type 2 diabetes mellitus.
22327174 GSTT1 gene polymorphism probably a risk factor for the development of osteoporosis in aging population.
22310945 The present study shows that the frequency of the GSTM1-/GSTT1- genotype was significantly higher and increased the risk of fetal growth retardation by 6.42 times in cases as compared to control subjects.
22296370 An increased CRC risk was significantly associated with the null genotypes of GSTT1 (OR=1.09, 95%CI=1.01-1.17, POR=0.027; I2=40.2%).
22296360 The pooled OR was 1.22 (95% CI 1.03 1.43) for the GSTM1 polymorphism while for GSTT1 polymorphism.
22248273 Genetic polymorphisms of GSTT1 is associated with lung adenocarcinoma.
22237425 This meta-analysis suggests that the null genotypes of GSTM1 and GSTT1 and the dual null genotype of GSTM1/GSTT1 were all not risk factors in colorectal cancer in Chinese population.
22234881 Copy number variations of GSTT1 is not associated with colorectal cancer risk or for an effective modification of cigarette smoking and menopausal hormone therapy.
22228187 GSTT1 single nucleotide polymorphism is not associated with colorectal cancer.
22225519 GST genotypes GSTM1, GSTT1 and GSTP1 (including SNPs) seem to have no relevant association with PLE
22215096 combined gene dose of GSTM1 and GSTT1 may influence outcome in childhood acute lymphoblastic leukemia.
22207314 Cells with mutated GSTT1 displayed enhanced polarization of mitochondrial membrane potential without increasing the apoptosis, suggesting that the age-associated upregulation of GSTT1 may influence the mitochondrial activity of granulosa cells.
22207177 The role of GSTM1, GSTT1, GSTP1 exon 5 and exon 6 polymorphisms on developing lung cancer, was investigated.
22207034 This meta-analysis suggested that there was lack of association between GSTT1 gene polymorphism and laryngeal cancer risk.
22183307 Endogenous DNA damage levels were analyzed in relation to polymorphisms in genes encoding phase I detoxifying enzyme-CYP1A1, phase II detoxifying enzymes-GSTM1, GSTT1, GSTP1 and enzyme involved in nucleotide excision repair-XPD.
22160572 The GSTM1/GSTT1 null genotype is a significant risk factor for developing chronic obstructive pulmonary disease in Asian smokers.
22154357 Data suggest that the GSTP1 polymorphism and its combination with GSTM1, and GSTT1 may be associated with bladder cancer susceptibility in the Iranian population.
22146408 GSTM1*0 and GSTT1*0 appear to be risk factors for acute lymphoblastic leukemia, and "rapid or intermediate NAT2 genotypes" are associated with an elevated risk for acute myeloid leukemia
22139978 GSTT1 null genotype and simultaneous deletion of both GSTT1 and GSTM1 genes was associated with lower enzyme activity,presence of Helicobacter pylori infection along with GSTT1*0 was associated with lower enzyme activity in patient with gastric cancer.
22126558 The present case control study suggests no association of GSTM1 and GSTT1 gene deletions with sporadic form of breast cancer in Pakistani population.
22116675 GSTT1 polymorphisms were associated with aristolochic acid nephropathy risk.
22058002 These results give evidence that the GSTT1- and GSTM1-null genotypes, alone or combined, are associated with increased risk of type-2 diabetes mellitus, regardless of smoking status.
22054067 genetic variability in members of the GST gene family may be associated with an increased susceptibility to renal cell carcinoma and its progression
22048273 Combined analysis of both genes revealed that 14.4 percent of Bahrainis, 16.3 percent of Lebanese and 21.0 percent of Tunisians harbor the deleted genotype of both the GSTM1 and GSTT1 genes
22048269 a significant association of combination of GSTT1 gene presence and homozygous absence of GSTM1 gene with bone mineral density was demonstrated
22027651 The results indicate a significant modifying role for GSTT1 gene polymorphism in the individual risk and severity of emphysematous changes
22018952 GSTT1 genotype is not predisposing for polycythemia vera.
22012226 the homozygous GSTT1 null polymorphism was highly associated with anti-TB drug-induced hepatotoxicity
22011249 Genetic polymorphisms of glutathione-S-transferase genes of GSTT1 is associated with nonalcoholic fatty liver disease.
21993019 This study demonistrated that no significant association between Indian Parkinson's disease patients and GSTT1 deletion polymorphism has been reported in Caucasians, Japanese and north Indian population.
21969307 In Turkish CML patients, the GSTM1(+) /GSTT1(-) genotype was associated with a 2.5-fold increased risk compared with the GSTM1(-)/GSTT1(+) genotype, the second most frequent genotype, suggesting a complex interaction between GSTM1 and GSTT1.
21962942 genetic associations: No significant associations were found for GSTT1 null polymorphism with intraepithelial cervical lesions or invasive cervical cancer. [Meta-Analysis; REVIEW]
21942242 Results indicate that ERCC1 and GSTT1-null polymorphisms may have an effect on acute myeloid leukemia (AML) risk that is dependent on smoking exposure.
21916987 Meta-Analysis: GSTT1 null genotype contributes to an increased colorectal cancer risk in the Asian population.
21916526 A small cohort of Hodkin's patients with an international prognostic score >3 and undeleted GSTT1 and/or GSTM1, treated with ABVD had worse progression-free survival.
21912475 GSTM1/GSTT1 null genotypes are associated with increased risk of hepatocellular carcinoma in Chinese population [meta-analysis]
21896242 genetic association studies in Chinese population: Data suggest that blood biomarkers of oxidative stress are associated with combined influences of GSTT1/GSTM1 genotype and fruit/vegetable consumption.
21890078 paternal smoking and exposure to toxicants for both parents affect the risk of children with CHD. Polymorphisms in GST genes can modify a person's risk of toxicant exposure-induced disease.
21875282 study found that carrying GSTT1 null genotypes significantly increases the risk of developing acute promyelocytic leukemia
21875259 Logistic regression yielding odd ratios resulted in no significant association between dietary isothiocyanates intake, GSTM1, GSTT1 or GSTP1 genotypes with oral cancer risk overall.
21870186 Data show that inherited combined CYP1A1 A4889G and T6235C abnormalities and GSTM1 and GSTT1 pathways are important determinants of HNSCC.
21868558 study demonstrated the role of both GSTM1 and T1 null genotypes in the development of high-grade cervical dysplasia in a Caucasian population
21848428 Individuals carrying CYP1A1 variant GSTT1 null genotypes had an 8.907-fold increased coronary artery disease risk compared to their wild status.
21843791 Data suggest a significant association between polymorphism of glutathione-S transferase T1/M1 genotypes and cytogenetic biomarkers which are considered early effects of genotoxic carcinogens.
21839153 GSTM1 and GSTT1 status may not influence the risk of developing gastric cancer.
21813807 F(2)-isoprostanes and malondialdehyde were lower in the GSTM1-0 and GSTT1-0 groups, respectively
21809368 VEGF and GST genotypes can combine to influence the risk for multiple myeloma in south-eastern Brazil. We hypothesize that the increased risk for disease related to the wild-type VEGF C936T and GSTM1 genotypes and the variant GSTT1 genotype.
21803734 Genetic polymorphism in GSTT1 is associated with colorectal cancer.
21798077 GSTT1 is marginally associated with increased urothelial carcinoma risk.
21786748 Data suggest that glutathione S-transferase M1, T1, and P1 genetic polymorphisms might affect hearing threshold levels for high frequencies only when workers are exposed to high noise levels.
21781954 examined the effects of two SNPs that alter amino acid residues in the dimer interface of the GST T1-1 protein and one that causes a conservative substitution in the core of the subunit
21775774 An association between male infertility and the GSTM1 and GSTT1 null deletion was observed, but not with the CYP1A1 polymorphism in North Iranian men with idiopathic infertility.
21743873 No correlation between GSTT1 polymorphism and chronic rhinosinusitis with and without nasal polyps, allergies, or asthma was observed.
21741269 this meta-analysis suggests that the GSTT1 null genotype is a risk allele for breast cancer development
21736951 study did not observe any significant association between null deletion of GSTT1 and DNA damage in workers occupationally exposed to organophosphate pesticides
21734345 Combined EPHX1, GSTP1, GSTM1, and GSTT1 genetic polymorphisms may play a signi fi cant role in the development of pulmonary emphysema.
21728793 Association between the GSTM1 null genotype and hypertension was significant in younger subjects. Tobacco users with the GSTT1 null genotype were at an increased risk
21694442 Significantly higher malondialdehyde levels in GSTM1-/GSTT1- compared to GSTM1+/GSTT1+ in both benign prostate hyperplasia and prostate cancer groups indicate higher oxidative stress in individuals with double deletions.
21681823 No significant association was observed between GST genotypes and disease risk in relation to smoking or occupational exposure.
21677662 Data show that 698 CNPs loci overlap with known disease-associated or pharmacogenetic-related genes such as CFHR3, CFHR1, GSTTI and UGT2B17.
21656129 association between the GSTT1 null phenotype and essential hypertension was confirmed in the overall population and in women, but not in men. These data suggest that GSTT1 could be a sex-specific candidate gene for EH
21651749 GST copy number variations were not significantly associated with respiratory outcomes and did not modify the effects of self-reported exposure to indoor sources of particulate matter on respiratory outcomes.
21629772 Findings indicate that GSTM1 and GSTT1 polymorphisms, particularly GSTM1-GSTT1 interaction, may play critical roles in the development of cervical neoplasia.
21619788 Urinary 1-hydroxypyrene concentrations can be modified by GSTM1, GSTT1 and GSTP1 gene polymorphisms.
21615880 results shed more light on the links between GSTM1/T1 genetics, oxidative stress, and vitiligo
21604464 The polymorphisms of GSTT1 and GSTM1 may affect the carcinogenesis of laryngeal carcinoma in the Han people in the Guangdong zone.
21586620 Our data indicate that common genetic variations in GSTM1, GSTT1, and GPX1 were not associated with bladder cancer risk.
21563941 Absence of association between GSTM1 and GSTT1 polymorphisms and melanoma susceptibility was found by meta-analysis.
21559761 GSTM1 and GSTT1 null genotype alone, both combined or combined with GSTP1 valine alleles, are associated with higher susceptibility to breast cancer development
21558497 Our assessment of gene-environment interactions suggested GSTM1 and GSTT1 are not involved in the in vivo human metabolism of estrogen and its metabolites
21557334 Flavonols and flavanols (EGC in particular) were associated with a reduced risk of breast cancer among those null for GSTM1 and GSTT1, with a P-value of 0.04 for the interaction between EGC and GSTM1 polymorphism
21546615 Results suggest that the GSTM1 and GSTT1 null genotypes may predispose sperm to increased oxidative damage in infertile men with varicoceles.
21545219 GSTT1 deletion polymorphism is associated with oral cancer progression.
21545198 GSTT1 downregulation is associated with head and neck cancer progression.
21543101 gstt1 is associated with a higher incidence of sister chromatid exchange, high frequency cell, and cytokinesis blocked micronuclei
21520994 The null genotype of GSTM1 and the dual null genotypes of GSTM1/GSTT1 were risk factors in cervical cancer, and the null genotype of GSTT1 was not associated with cervical cancer risk.
21513434 There were no significant differences in the distribution of homozygous null Glutathione-S-transferase T1 between chronic obstructive pulmonary disease patients and healthy controls in a north Indian population.
21508403 GSTT1 null genotype is associated with gastric pre-malignant conditions.
21499713 a reduction in the frequency of GSTT1-null genotypes might be involved in the pathogenesis of coronary artery disease in an Iranian population
21488930 Although the GST-M1 null genotype was higher in Grade 3 than in Grade 1, 2 and controls, there were no statistical differences between control group and varicocele groups according to GST-M1 and GST-T1 null genotype.
21461548 Results suggest that subjects carrying both GSTM1 and GSTT1 null polymorphisms and experiencing sunburns in childhood have an extremely high risk of melanoma.
21458313 No relationship between GSTT1 and GSTM1 genotypes and renal cell carcinoma risk was observed
21436184 GSTM1 null genotype may be associated with a higher risk of oral cancer in Asians but not in Caucasians, and this effect may be modified by smoking status
21431478 The response rates to breast cancer chemotherapy were better, although not significantly so, in patients with the GSTM1 and GSTT1 null genotypes (odds ratio [OR] 2.06 and 1.45).
21429837 Our findings indicate no association between methylation status and expression profiles of GSTT1 gene and NAFLD
21389716 significant protective effect of GSTT1 null in risk for myocardial infarction in smokers
21359474 results suggest a possible interaction between meat intake and GSTM1/GSTT1 polymorphisms in modulating the risk of head and neck cancer, influenced by vegetable consumption.
21358205 GSTT1 polymorphism is associated with oral submucous fibrosis.
21352813 GSTM1, GSTT1 and GSTP1 variants might contribute to the development of T2DM and GSTT1 variant alone is involved in the development of T2DM associated coronary artery disease complications in the South Indian population.
21349909 analysis of glutathione S-transferase copy number variation alters lung gene expression
21334974 A significant increase in DNA damage was detected in GSTT1-deficent subject lymphocytes exposed to a water solution of oil fly ash formed by the distinctive transition metals vanadium, iron, and nickel.
21309732 combined genetic polymorphisms of GSTM1, GSTT1, GSTP1, and EPHX1 may have favorable effects on redox balance in chronic obstructive pulmonary disease patients.
21301992 The frequencies of the GSTT1(null) genotype was significantly higher in patients with distal colitis than in extensive colitis.
21292509 Data indicate there were no statistical changes in the genotype distribution of GSTM1, MDR1 C3435T, and VEGF A2578C gene polymorphisms were observed between cases and controls.
21254556 Cytochrome P4501A1, glutathione S-transferase M1 and T1 gene polymorphisms in chronic myeloid leukemia
21243434 GSTT1-null is associated with IBD, while GSTM1-null is conversely associated with inflammatory bowel disease. No association was found between GSTT1- null or GSTM1-null and specific inflammatory bowel disease phenotypes.
21243008 The results obtained demonstrated that simultaneous presence of three potentially risk alleles (GSTM1 null, GSTT1 null and GSTP1 Val) lead to a significant OR increase for prostate cancer.
21234761 We evaluated the influence of common polymorphisms of XRCC1, GSTP1, GSTT1, and GSTM on the individual susceptibility to CpG island hypermethylation in the non-neoplastic rectal mucosa in ulcerative colitis patients
21228718 the GST theta;1-null genotype and the 139A--G mEh gene polymorphism may enhance the susceptibility to acquired aplastic anemia
21212706 Our findings suggest that genetic polymorphisms of glutathione S-transferase (GST) M1, GSTT1 and GSTP1 may have a role in the development of (AMD) age-related macular degeneration.
21176850 Data shsow that the null genotype of GSTT1 was correlated MDS patients with complex aberrant karyotype.
21162838 PON1-192 and GST T1 gene were associated with the farmer's health condition after pesticides exposure.
21158083 GSTT1 and GSTP(1-105) genotype may be associated with susceptibility response to altitude hypoxia.
21156236 GSTT1 copy number gain has a role in resistance to escalated-dose imatinib treatment in chronic myeloid leukemia
21152927 genetic association studies in Slovakian workers exposed to oxidants/oxidative stress: Subjects missing GSTT1 and GSTM1 due to gene deletions have lower levels of vitamin C in plasma.
21151336 There is a significant involvement of the GSTT1 and GSTM1 polymorphisms in female Pakistani patients having pseudoexfoliative glaucoma.
21150818 No significant associations were detected in either non-Chinese or Chinese populations concerning the GSTT1 null genotype.
21133595 These results suggest that the GSTM1 and GSTT1 null genotypes are risk factors for head and neck cancer development among the Pakistani population.
21109554 The frequency of incense burning was associated with increased risk of current asthma, medication use, lifetime wheeze, nocturnal wheeze and exercise wheeze in an exposure-response manner among children with glutathione S-transferase theta1 null genotyp.
21107716 The objectives of the present work are (1) to verify whether genetic polymorphism in the detoxification gene GSTT1 influences the endogenous sensitivity in terms of sister chromatid exchanges (SCEs)/cell in healthy donors.
21097530 polymorphisms of GSTT1, EPHX1, MTHFR, MTR and NAT2 differentially affect the frequency of chromosomal aberration frequencies in lymphocytes.
21089003 we investigated whether CAG repeat length in androgen receptor gene and GSTM1 and GSTT1 polymorphisms influence prostate cancer risk in Iranian newly diagnosed cancer patients
21089003 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
21086258 null genotypes of GSTM1 and GSTT1 genes were predominant in patients with nodules, indicating that individuals that possess these genotypes have a predisposition for thyroid disease
21086258 Observational study of gene-disease association. (HuGE Navigator)
21079384 GSTT1 is correlated with characteristics of aggressive BC.
21079384 Observational study of gene-disease association. (HuGE Navigator)
21079113 No significantly increased risk of surgical complications was noted in patients with the null genotypes in the GSTT1 gene.
21075030 Both oral contraceptives use and GSTT1 and GSTM1 genotypes may influence IGF-1 levels.
21075030 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21058530 Association with the development of severe perinatal asphyxia was detected for the deletion polymorphism in GSTT1 gene and the combination of the GSTT1 absent/GSTM1 absent in the newborns.
21058530 Observational study of gene-disease association. (HuGE Navigator)
21053180 Observational study of gene-disease association. (HuGE Navigator)
21051083 genetic polymorphism influences risk of asthma associated with early gestation acetaminophen exposure
21051083 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21045267 In multivariate regression analysis, the GSTT1-positive genotype was the independent predictor for recurrence and progression in non-muscle-invasive bladder cancer
21045267 Observational study of gene-disease association. (HuGE Navigator)
21038299 Observational study of gene-disease association. (HuGE Navigator)
21037224 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20977336 The GSTT1 polymorphism influences the outcome of Brazilian patients with Hodgkin lymphoma.
20977336 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20970553 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20966642 GSTM1, GSTT1, and GSTP1 genotype polymorphisms do not seem to confer any additional risk for ovarian cancer
20966642 Meta-analysis of gene-disease association. (HuGE Navigator)
20957336 Observational study of gene-disease association. (HuGE Navigator)
20954980 Results suggest that GSTT! and/or GSTM1 null gneotypes are associated with higher oxidative stress in both diabetic and nondiabetic chronic kidney insufficiency.
20954980 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20951227 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20942828 Bladder cancer susceptibility found in patients with polymorphic deletions of the GSTT1 gene.
20942828 Observational study of gene-disease association. (HuGE Navigator)
20935060 Observational study of gene-disease association. (HuGE Navigator)
20922139 Observational study of gene-disease association. (HuGE Navigator)
20890814 Observational study of genotype prevalence. (HuGE Navigator)
20884258 The study showed absence of association for CYP1A1 2B, CYP1B1 2, GSTM1 0, and GSTT1 0 for prostate cancer
20884258 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20878561 Genetic polymorphisms of GSTT1 is not associated with gastric carcinoma.
20878561 Observational study of gene-disease association. (HuGE Navigator)
20878130 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20855412 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20854097 The GSTT1 null genotype appeared to play a protective role for lung cancer in several regions of NE India. the GSTT1 null genotype was found to be a significant risk factor for oral & gastric cancer in the Assam region of NE India.
20854097 Observational study of gene-disease association. (HuGE Navigator)
20853551 GSTM1 *0 *0 or GSTT1 *0 *0 or both null genotypes, do not appear to be associated with ATD-induced hepatotoxicity in our Indian population.
20853551 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20850372 Observational study of gene-disease association. (HuGE Navigator)
20847076 GSTT1 deletion is associated with severe pulmonary fibrosis; the GSTM1 deletion may have a role in the development of pleural plaques
20847076 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20845989 Observational study of gene-disease association. (HuGE Navigator)
20843117 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20842440 The objective of the present study was to investigate the role of GSTM1 and GSTT1 null genotypes as risk factors for chronic obstructive pulmonary disease (COPD) and prostate cancer.
20842440 Observational study of gene-disease association. (HuGE Navigator)
20824655 Observational study of gene-disease association. (HuGE Navigator)
20817763 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20812880 Single nucleotide polymorphisms resulting in lower enzymatic activity in GSTT1 was found to be correlated with noise-induced hearing loss.
20812880 Observational study of gene-disease association. (HuGE Navigator)
20805158 Maternal smoking was associated with reduced childhood FEF(25-75) only in mother-child pairs with both copies of GSTM1 deleted or at least one copy of GSTT1 present
20805158 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20802377 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20740495 Observational study of gene-disease association. (HuGE Navigator)
20739761 the first study showing the association of a combined effect of GSTM1, T1 and P1 genotypes in a representative cohort of Indian patients with Type 2 diabetes mellitus
20739761 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20734807 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20731606 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20728566 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20723587 Observational study of gene-disease association. (HuGE Navigator)
20708344 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20705574 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20701904 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20688591 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20686491 Meta-analysis of gene-disease association. (HuGE Navigator)
20683151 Genetic polymorphism of glutathione S transferases T1 is associated with hepatocellular carcinoma.
20683151 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20676536 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20675267 subjects with polymorphisms in GSTT1 have a higher trihalomethanes induced bladder cancer susceptibility
20675267 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20674986 This finding of this study indicated that GSTT1 candidate polymorphisms for susceptibility to Bipolar disorder among adolescents.
20674986 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20672371 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20672314 GSTT1 and GSTM1 null genotypes do not associate with increased risk of hepatocellular carcinoma.
20672314 Observational study of gene-disease association. (HuGE Navigator)
20670164 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20663906 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20661823 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20661821 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20661602 The present study aimed to examine an association between the glutathione S-transferases (GSTs) polymorphisms (GSTM1, GSTT1, and GSTP1) genetic polymorphisms with the risk and expression in children with isolated Hirschsprung disease.
20661602 Observational study of gene-disease association. (HuGE Navigator)
20658008 data show that polymorphisms in GSTM1 and GSTT1 genes have no influence on the ototoxicity of aminoglycosides.
20658008 Observational study of gene-disease association. (HuGE Navigator)
20656381 There are no significant differences in overall rate, total amount of excretion, and the time of peak excretion of isothiocyanates after drinking watercress juice between the null and positive GSTT1 and M1 genotypes.
20656381 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20656020 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20647132 The GSTT1 null genotype was present in 34 percent of control patients and in 60 percent of white presbycusis subjects.
20647132 Observational study of gene-disease association. (HuGE Navigator)
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20638463 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20637790 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20621079 GSTM1-/GSTT1- (null) genotype may be one of the associated genetic factor for the increased risk of PTL.
20621079 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20610557 Observational study of gene-disease association, gene-gene interaction, and genetic testing. (HuGE Navigator)
20608166 Observational study of gene-disease association. (HuGE Navigator)
20599479 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20597111 Significant gene-environment interactions between the GSTT1-null polymorphism and heavy smoking were observed when assessing the risk of rheumatoid arthritis.
20597111 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20577625 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20577141 This study aims to investigate the genotype frequencies of GSTM1, GSTT1 and GSTM3 genes in 80 osteosarcoma patients and 160 normal control participants, and also the influence of these polymorphisms in the clinical outcome of osteosarcoma patients.
20577141 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20574021 The present meta-analysis suggested that GSTM1 and GSTT1 null genotypes are associated with increased risk for senile cataract in Asian populations but not in Caucasian populations.
20574021 Meta-analysis of gene-disease association. (HuGE Navigator)
20568895 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20568049 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20563854 analysis of GSTT1 and GSTM1 gene polymorphisms in European and African populations
20563854 Observational study of genotype prevalence. (HuGE Navigator)
20563767 the GSTT1 polymorphism constitutes an inherited determinant of intratumoral angiogenesis in sporadic breast cancer
20563767 Observational study of gene-disease association. (HuGE Navigator)
20561699 This meta-analysis suggests null genotypes of GSTM1 and GSTT1 are both associated with increased HCC risk in Asians, and individuals with the dual null genotype of GSTM1/GSTT1 are particularly susceptible to developing HCC. Review.
20561699 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20554493 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20547701 The GSTT1 and GSTM1 null genotypes, either present both or only one in a single subject, have a modifying effect on birth weight among smoking women
20547701 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20542754 Meta-analysis suggests that GSTT1 deletion polymorphisms may have an effect on the susceptibility of lung cancer in Chinese population.
20542754 Meta-analysis of gene-disease association. (HuGE Navigator)
20540773 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20534171 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20529827 There were no significant associations between glutathione-S-transferases and p53 expressions and tumor stage, tumor grade and smoking status (p>0.05).
20521623 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20517701 GSTT1 and glutathione S-transferase mu1 (GSTM1) null genotypes, together with hypertension, may play a significant role in the pathogenesis of ischemic stroke.
20517701 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20514077 Copy number variation in GSTT1 and GSTM1 predict incidence and 5-year survival from prostate and bladder cancer, and incidence of corpus uteri cancer.
20514077 Observational study of gene-disease association. (HuGE Navigator)
20505681 GSTM1 or GSTT1 null genotypes, or wild type GSTP1 with GSTM1 null or GSTT1 null, increase risk for developing infertility, but the nondeletion GSTM1 and GSTT1 genotypes are protective factors
20505681 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20501762 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20495862 The GSTM1 null allele is likely not an independent risk factor for chronic obstructive pulmonary disease (COPD) but is related to emphysema, whereas the GSTT1 gene is not associated with the disease.
20495862 Observational study of gene-disease association. (HuGE Navigator)
20488846 The relationship between urinary HA and 8-OHdG concentration is modified by genetic polymorphisms of some metabolizing enzymes such as GSTM1, GSTT1, and ALDH2.
20488846 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20484876 Meta-analysis of gene-disease association. (HuGE Navigator)
20472488 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20464961 No association between frequency of chromosomal aberrations and polymorphism for GSTM1 and GSTT1 was observed.
20464961 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20461808 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20459744 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20459474 Observational study of gene-disease association. (HuGE Navigator)
20459366 The GST genotypes do not seem to be important in susceptibility of inflammatory bowel disease in the Danish population
20459366 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20444272 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20437058 Observational study of genetic testing. (HuGE Navigator)
20430047 Observational study of gene-disease association. (HuGE Navigator)
20426969 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20409775 No associations were observed between GSTT1 and esophageal squamous cell carcinoma.
20409775 Observational study of gene-disease association. (HuGE Navigator)
20402821 Among Indian male smokers with and without COPD, the frequencies of homozygous null genotypes of GSTT1 were significantly higher in COPD cases. The GSTT1 null genotype may be associated with the susceptibility to COPD.
20402821 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20401725 Ethnicity affects the genetic association of GSTT1 with rheumatoid arthritis in South Asian and Caucasian patients living in East Midlands/United Kingdom.
20401725 Observational study of gene-disease association. (HuGE Navigator)
20391338 Polymorphisms in GSTM1, GSTM3, GSTT1, and GSTP1 do not influence the risk of primary glioma, at least in this population in Rio de Janeiro, Brazil.
20391338 Observational study of gene-disease association. (HuGE Navigator)
20391138 Observational study of gene-disease association. (HuGE Navigator)
20391126 Observational study of gene-disease association. (HuGE Navigator)
20390895 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20385995 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20381444 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20377137 Observational study of gene-disease association. (HuGE Navigator)
20375710 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20373852 Observational study of gene-disease association. (HuGE Navigator)
20370484 Association of GSTM1 and GSTT1 gene deletions with susceptibility to DNA damage in the pesticide-exposed workers.
20370484 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20368715 Observational study of gene-disease association. (HuGE Navigator)
20367187 the frequencies of GSTA1 (glutathione S-transferase alpha 1), GSTM1(GST mu 1 ), GSTO2(GST omega 2) and GSTT1(GST theta 1) genotypes found in asthmatic patients differ from those of controls
20367187 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20359083 GSTT1 genotypes had no association with laryngeal and hypopharyngeal carcinoma risk.
20359083 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20357201 Observational study of gene-disease association. (HuGE Navigator)
20354063 Genetic polymorphisms of glutathione S-transferase genes GSTT1 and risk of coronary heart disease
20354063 Meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
20348973 Detection of anti-GSTT1 antibodies in patients with a GSTT1-null genotype before transplantation may be predictive of graft rejection in the event of a GSTT1-positive donor.
20335620 An association was observed between GSTT1 copy number variation and age-related cataract in a Han Chinese population.
20335620 Observational study of gene-disease association. (HuGE Navigator)
20331623 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20306695 Findings suggest that GSTM1 and GSTT1 polymorphisms appear to be associated with a modest increase in the risk of HCC in Egyptian patients.
20303013 This study suggests that GSTT1 deletion may significantly increase the risk of drug-related toxicity after R-CHOP chemotherapy in patients with DLBCL, and is associated with worse prognosis in males.
20303013 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20301895 Observational study of gene-disease association. (HuGE Navigator)
20300859 There is no evidence that XRCC1 polymorphisms have advantage/disadvantage when population exposed to natural sour gas. The polymorphisms of GSTM1 and GSTT1 modulate serum testosterone concentration in young females exposed to natural sour gas.
20300859 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20297661 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20226777 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20216541 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20214911 the GSTT1 non-null genotype was associated with reduced sperm concentration and count in semen.
20214911 Observational study of gene-disease association. (HuGE Navigator)
20207535 GSTT1 null allele carriers exhibited increased colorectal cancer risk in Caucasian populations (OR=1.312, 95% CI: 1.119-1.538, random effects); the association in Chinese subjects was not significant (OR=1.068, 95% CI: 0.788-1.449, random effects).
20207535 Meta-analysis of gene-disease association. (HuGE Navigator)
20203006 Observational study of genetic testing. (HuGE Navigator)
20200426 We observed suggestive associations between survival and GSTT1 copy number and GSTA5, GSTM4, and ABCC4 single nucleotide polymorphisms
20200426 Observational study of gene-disease association. (HuGE Navigator)
20197727 No significant difference was observed between subjects with dysmenorrhea and subjects without dysmenorrhea for polymorphisms of glutathione S-transferase theta 1 gene.
20197727 Observational study of gene-disease association. (HuGE Navigator)
20194081 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20194072 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20190330 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20187096 Among the patients with oligodendroglial tumors (n = 94), patients who had the GSTT1 null genotype had a 2.9 times increased risk of death (95% confidence interval [CI], 1.3-6.3) compared with patients who had the GSTT1 non-null genotype
20187096 Observational study of gene-disease association. (HuGE Navigator)
20177288 Fetal GSTT1 (glutathione S-transferase theta 1) deletion significantly and specifically modifies the effect of smoking on gestational age-corrected birth weight.
20177288 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20156772 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20136364 Observational study of genetic testing. (HuGE Navigator)
20134034 GST-T1 null genotype and increased oxidative stress may play a role in asthma pathogenesis in children.
20134034 Observational study of gene-disease association. (HuGE Navigator)
20131310 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20130515 The GSTM1 and GSTT1 null genotypes were overrepresented in papillomavirus-infected patients and in women with cervical intraepithelial neoplasia 2 or 3, although without any significant associations.
20120433 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20110814 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20109103 the influences of the haptoglobin, MnSOD, CAT, GPX1, ACE, glutathione S-transferases M1 (GSTM1) and T1 (GSTT1) genes' polymorphisms on the oxidative stress and damage suffered by human runners was studied
20109103 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20100551 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20097269 Functional divergence between human and rat Theta class GST demonstrates that a single point mutation can enable or suppress enzyme activities with different substrates.
20095411 Genetic peculiarities particularly xenobiotic detoxification enzymes CYP1A1, CYP2E1, EPHX1 and GSTM1, GSTT1 play important role in pulmonary diseases development.
20095411 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20093049 Observational study of gene-disease association. (HuGE Navigator)
20091863 Modifyling effect of GSTT1 polymorphism on the risk of early-onset lung cancer.
20091863 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20088379 Observational study of gene-disease association. (HuGE Navigator)
20083259 GSTT1 deletion leads to renal cell carcinoma onset at a young age
20083259 Observational study of gene-disease association. (HuGE Navigator)
20074657 In contrast to patients with allogeneic blood and marrow transplantation (BMT), in patients with autologous BMT, a deletion polymorphism in GSTM1 and/or GSTT1 was significantly associated with the occurrence of overall (drug and/or radiation) toxicity.
20074657 Observational study of gene-disease association. (HuGE Navigator)
20073549 allelic polymorphisms of GSTM1 and GSTT1 were analyzed in three ethnic groups of North East India where a high prevalence of various cancers and other diseases such as hypertension, tuberculosis, and asthma have been reported
20073549 Observational study of genotype prevalence. (HuGE Navigator)
20070240 Significantly suppressed GSTM1 and GSTT1 mRNA and GSTM1 protein expression was observed in cultures of keratinocytes derived from unaffected and affected skin of vitiligo patients, and in their co-cultures with allogeneic melanocytes.
20069434 On studying the association of GSTT1 null gene polymorphisms with cervical cancer lesions, independently on smoking habit, seems to be related to a 5.7-fold increased risk of developing CLs with a considerable statistical significance (P = 0.0091).
20069434 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20063011 The Polymorphisms in GSTT1 gene alter the ability of the enzyme to metabolize carcinogens.
20063011 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20061204 Study demonstrates that GSTT1 null genotype is associated with an increased risk of colorectal cancer, specifically, among Caucasians.
20061204 Meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
20056632 the inverse association between glucosinolate intake and prostate cancer risk was modified by NQO1 (C609T) and GSTM1 and GSTT1 deletion polymorphisms.
20056632 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20056567 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20056207 The nondeletion genotype of the GSTT1 gene was found to be strongly associated with the increased risk of idiopathic male infertility and asthenozoospermia.
20056207 Observational study of gene-disease association. (HuGE Navigator)
20049629 Data show that the distribution of GSTM1 and GSTT1 polymorphisms is not significantly different between lung cancer patients and the controls, suggesting that they are not independent risk factors for lung cancer.
20049629 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20049212 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20049130 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20042523 This study suggests that isothiocyanate exposure may reduce the risk of colorectal cancer, and this protective effect may be modified by the GSTM1 and GSTT1 genes.
20042523 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20036620 Observational study of gene-disease association. (HuGE Navigator)
20032816 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20032267 Meta-analysis of gene-disease association. (HuGE Navigator)
20029944 Observational study of gene-disease association. (HuGE Navigator)
20029178 findings suggest that subjects with the glutathione S-transferase T1(GSTT1)-null genotype were more susceptible to oxidative damage in smokers than the GSTT1-positive subjects
20029178 Observational study of gene-disease association. (HuGE Navigator)
20026093 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20017670 genotype and copy number variants not associated with survival in colorectal neoplasm patients treated with chemotherapy
20017670 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20012094 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19963114 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19960570 Data show that glutathione S-transferases mu and theta null genotypes were not associated with increased risk of gastric or colorectal cancer in Koreans.
19960570 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19960261 This meta-analysis suggests that GSTT1 gene polymorphism may be not associated with increased gastric cancer risk among Europeans, Americans, and East Asians.
19960261 Meta-analysis of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19953622 no significant association between the susceptibility of oral cancer and genetic polymorphism for GSTA1, GSTT1, and GSTM1.
19953622 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19947517 Observational study of gene-disease association. (HuGE Navigator)
19933708 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19927646 GSTT1 and CYP2E1 positive genotypes were not genetic risk factors for development of abnormal liver function in workers exposed to N, N-dimethylformamide.
19927646 Observational study of gene-disease association. (HuGE Navigator)
19922706 No association was found between the GSTT1 and GSTM1 null variants and laryngeal cancer.
19922706 Observational study of gene-disease association. (HuGE Navigator)
19921428 GSTT1 deletion variants did not modify breast cancer risk for 718 women BRCA1 and BRCA2 mutation carriers from Australia, the UK, Canada, and the USA.
19921428 Observational study of gene-disease association. (HuGE Navigator)
19917083 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19914269 Observational study of gene-disease association. (HuGE Navigator)
19902106 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19900941 Clinical trial of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19899130 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19896490 Observational study of gene-disease association. (HuGE Navigator)
19892789 Data observed significant protective effects of phase I wild-type genotypes and association of the GSTT1 null genotype with recurrent miscarriages.
19892789 Observational study of gene-disease association. (HuGE Navigator)
19884712 GSTT1 null genotype was present in 75% of the controls, 66.6% oral cancer patients, 63.3% of leukoplakia cases, and in 63.3% of the oral submucous fibrosis cases.
19884712 Observational study of gene-disease association. (HuGE Navigator)
19874347 Results show the existence of a correlation between solar keratosis and GSTT1 null genotype which points out differences in subjects of different ethnic, geographical origin and warrants further investigation on larger and ethnically different populations
19874347 Observational study of gene-disease association. (HuGE Navigator)
19863340 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19860557 the accumulated evidence indicated an association between GSTT1 null genotype and chronic myeloid leukemia.
19860557 Meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
19850945 In smoking mothers, infant and/or maternal GSTT1(glutathione S-transferase theta 1) nonnull was associated with reduced airway responsiveness throughout the first year and increased functional residual capacity at 6 months.
19850945 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19843669 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19843381 Significant growth inhibition by rapamycin was observed among stable transformants for the mutant GSTT-1 gene, but not wild type GSTT-1 gene, and was indicative of typical apoptosis.
19842992 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19838709 aimed to compare the prevalence of GST deletions in beta thalassemia patients with controls. observed significantly higher frequency of GSTT1 (P = 0.001) and GSTT1/GSTM1 (P = 0.03) in comparison to controls.
19838709 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19823950 GST polymorphisms maybe modify the effect on markers of oxidative stress and inflammation in Chinese coronary artery disease patients.
19823950 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19818869 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19816935 The GSTT1 null genotype is a significant risk factor for MDS development.
19816935 Meta-analysis of gene-disease association. (HuGE Navigator)
19811334 Borderline significance was seen for AML risk with GSTT1 null genotypes. No heterogeneity was seen in studies that evaluated GSTT1.
19811334 Meta-analysis of gene-disease association. (HuGE Navigator)
19800766 Observational study of gene-disease association. (HuGE Navigator)
19799358 Observational study of gene-disease association. (HuGE Navigator)
19799150 The frequencies of GSTM1 and GSTT1 'null' genotypes were different among ethnic groups and smear-positive pulmonary tuberculosis cases.
19798506 There was a small increased risk of colorectal cancer for individuals with GSTT1 null, especially for Caucasians populations and Asian populations.
19797843 Certain maternal genetic polymorphisms in the polycyclic aromatic hydrocarbons (PAHs)-metabolizing enzymes have been shown to enhance the association between maternal smoking and infant birth weight in both Caucasians and Japanese.
19786980 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19786118 Combination of GSTT1-null and GSTP1-codon 105 Val variants further increased the risk for pancreatic cancer.
19782926 GSTT1 is a potential genetic factor to predict development of essential hypertension and permit early therapeutic intervention
19782926 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19779959 These data suggest that glutathione S-transferase T 1 null status is associated with a modest increase in the risk of bladder cancer and the difference exiting in source of control has been confirmed.
19779959 Meta-analysis of gene-disease association. (HuGE Navigator)
19778234 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19774638 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19768671 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19760040 polymorphisms of both GSTT1 and GSTP1 genes seem associated with elevated breast cancer risk in a race-specific manner
19760040 Meta-analysis of gene-disease association. (HuGE Navigator)
19752172 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19750077 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19748847 GSTM1 and GSTT1 genotype were not associated with survival in African American and white patients with colorectal cancer
19748847 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19741569 glutathione S-transferase theta 1 genotypes among testicular germ cell tumor survivors: associations with primary and post-chemotherapy tumor histology
19741569 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19731014 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19718946 GSTT1-null genotypes were found to have higher risk of developing leukoplakia (OR 1.94, 95% CI 2.61-18.54).
19718946 Observational study of gene-disease association. (HuGE Navigator)
19710200 GSTT1 may protect against serum ascorbic acid deficiency when dietary vitamin C is insufficient.
19710200 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19705749 Observational study of gene-disease association. (HuGE Navigator)
19701760 The distribution of GSTM1 null genotypes was not significantly different between the NP patients and controls and there was also no significance between the GSTP1 genotypes and NP. GST gene polymorphisms may be important in pathogenesis of NP.
19701760 Observational study of gene-disease association. (HuGE Navigator)
19701675 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19700502 Meta-analysis of gene-disease association. (HuGE Navigator)
19696793 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19669596 GSTM1 and GSTT1 polymorphisms may play a role in the development of lung cancer for some histological subtypes and modifies the risk of smoking-related lung cancer.
19669596 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19664997 Single-nucleotide polymorphic variants of GSTT1 differ in stability and functional properties.
19664521 Carriers of null GSTM1 genotype were at high risk of developing COPD especially when they were null GSTT1 and GSTM1 haplotype.
19664521 Observational study of gene-disease association. (HuGE Navigator)
19663315 Carriers of GSTTI gene deletion were found to be more subjected to a risk of emerging non-small-cell lung cancer (NSLC) than those of normal GSTT1(+) genotype.
19663315 Observational study of gene-disease association. (HuGE Navigator)
19662515 GSTM1 and GSTT1 null genotypes have protective role(s) for developing coronary heart disease.
19662515 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19656722 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19651439 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19643719 Observational study of gene-disease association. (HuGE Navigator)
19643173 GST genetic polymorphisms may modify the susceptibility to noise-induced temporary threshold shift in factory workers.
19643173 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19640174 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19635899 We did not find a significant relationship with the GSTT1 polymorphism and severe malaria anemia.
19635899 Observational study of gene-disease association. (HuGE Navigator)
19629346 There was no relationship between absence the of genes GSTT1 and GSTM1 and prognosis of papillary thyroid carcinoma when compared to the AMES classifications.
19629346 Observational study of gene-disease association. (HuGE Navigator)
19621425 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19618282 Genetic polymorphisms of glutathione S-transferase genes GSTP1, GSTM1, and GSTT1 and risk of esophageal and gastric cardia cancers.
19618282 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19610060 GSTM1 polymorphisms are associated with gastric cancer.
19610060 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19589847 Observational study of genetic testing. (HuGE Navigator)
19589345 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19576039 No significant association was observed between anti-tuberculous drug induced hepatic injury and GST T1 polymorphism.
19571817 individuals with homozygous deletion of GSTT1 and/or GSTM1 have a greater predisposition to vitiligo
19568698 GSTs may hold promise as therapeutic targets in more advanced prostate cancers, particularly, in African-Americans.
19564823 Observational study of gene-disease association. (HuGE Navigator)
19555437 Observational study of gene-disease association. (HuGE Navigator)
19548560 GSTT1 and GSTM1 genotypes had no effect on urinary 1-hydroxypyrene following PAH exposure.
19548560 Observational study of gene-environment interaction. (HuGE Navigator)
19538885 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19537956 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19528831 Characterize a series of polymorphisms of genes, such as CYP2E1, GSTM1, GSTT1, and particularly EPHX1, involved in butadine (BD) metabolism in very low BD exposure level.
19528831 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19521675 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19515364 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19506726 Meta-analysis of gene-disease association. (HuGE Navigator)
19504558 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19491810 Observational study of gene-disease association. (HuGE Navigator)
19484507 the factors modifying significantly the melanoma risk associated with CDKN2A mutations (stepwise procedure) were: MC1R and dysplastic nevi (increasing the risk) and GSTT1 (decreasing the risk).
19484507 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19481674 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19473562 the presence of the GSTT1-0 (glutathione S-transferase theta 1)genotype contributed to higher disease activity in Rhematoid arthritis patients. The risk for developing highly active RA was the highest in smokers with the GSTT1-0 genotype
19473562 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19469640 Observational study of gene-disease association. (HuGE Navigator)
19469619 Genetic polymorphisms of GSTM1, GSTT1 and CYP1A1 may not be risk factors for oral cancer in the Jakarta population
19469619 Observational study of gene-disease association. (HuGE Navigator)
19440446 no statistically significant interaction between maternal smoking, GSTT1-present and GSTM1-null genotypes for low birth weight
19430957 The genetic polymorphism of GSTT1, GSTM1 and GSTO2 N412D in three Iranian populations was detected.
19430957 Observational study of genotype prevalence. (HuGE Navigator)
19424928 The increase of plasma isothiocyanates concentration was independent of the GST genotype.
19424928 Clinical trial of gene-disease association. (HuGE Navigator)
19424794 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19419718 data suggest that the presence of a double deletion genotypes of the GSTM1 and GSTT1 genes is associated with hypertriglyceridemia and low HDL-cholesterol levels in humans.
19419718 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19407363 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19401526 no statistically significant associations were observed with GSTT1, polymorphisms and risk of second primary malignancy (SPM) after index squamous cell carcinoma of the head and neck development
19401526 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19399747 Report risk factors for developing de novo autoimmune hepatitis associated with anti-glutathione S-transferase T1 antibodies after liver transplantation.
19394866 No clear associations were observed for GSTT1 genotypes.
19394866 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19391035 Observational study of gene-disease association. (HuGE Navigator)
19383894 GSTT1 SNPs do not support the role of genetic variation in the catechol estrogen metabolism pathway and breast cancer risk in postmenopausal women.
19383894 Observational study of gene-disease association. (HuGE Navigator)
19380028 case-control study to assess the role of smoking, glutathione S-transferase T1 variants, null genotypes in bladder cancer development in North Tunisia.
19376514 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19362955 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19347979 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19338664 Meta-analysis of gene-disease association. (HuGE Navigator)
19336732 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19332728 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19317600 The investigators found evidence of polymorphisms in the GSTT1*0 haplotype in a Mexican Mestizo population, which suggests an increased susceptibility to environmental carcinogens.
19317600 Observational study of genotype prevalence. (HuGE Navigator)
19307236 Observational study of gene-disease association. (HuGE Navigator)
19303722 It is suggested that NAT2 slow-acetylator, GSTM1 null, GSTM1/GSTT1-double null, and variant CYP2A6 genotypes may play important roles in the development of bladder cancer in Henan area, China
19303722 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19303595 High DDE-DDT exposure adversely affected sperm parameters and its effects were exacerbated by the GSTT1 null polymorphism and by the CYP1A1 common alleles.
19303595 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19287511 Analysis of GSTT-1 polymorphisms showed no association with mitochondrial genome instability.
19287511 Observational study of gene-disease association. (HuGE Navigator)
19286687 GST malfunction in GST deletion genotypes may interfere with metabolism of oxidative intermediates and may exacerbate direct or indirect pathological effects of oxidative stress on the optic nerve in the setting of these spontaneous optic neuropathies.
19286687 Observational study of gene-disease association. (HuGE Navigator)
19270789 The results substantiate the cancer risk predictivity of chromosomal aberrations frequency, ruling against a strong modifying effect of GSTM1 and GSTT1 polymorphisms.
19270789 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19267064 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19265530 Observational study of gene-disease association. (HuGE Navigator)
19264525 Observational study of genotype prevalence. (HuGE Navigator)
19258736 Glutathione s-transferase variants in a brazilian population
19258736 Observational study of genotype prevalence. (HuGE Navigator)
19254865 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19253001 No statistically significant correlation was present between GSTM1 null and GSTT1 null genotypes with an acute rejection episode in transplant recipients.
19253001 Observational study of gene-disease association. (HuGE Navigator)
19252342 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19244254 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19223573 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19222528 Meta-analysis of gene-disease association. (HuGE Navigator)
19209780 There was a significant increased risk for bladder cancer development in patients with GST-M1 and GST-T1 combined gene deletion which was represented mainly in S. haematobium patients with bladder cancer.
19209780 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19203783 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19190172 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19183974 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19177501 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19174490 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19169061 For GSTT1 genotypes, the presence of the null genotype was spread over 19.70% of the overall population (no.=335). the incidence of this genotype was almost the same in thyroid cancer patients (20.69%) as in the control group (18.86%).
19169061 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19157724 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19151739 GSTT1 genotype is associated with improvement of semen parameters after varicocelectomy
19151739 Observational study of gene-disease association. (HuGE Navigator)
19148781 Observational study of gene-disease association. (HuGE Navigator)
19147266 Almost half of smokers who carried a GSTT1 null genotype delivered a baby with fetal growth restriction.
19147266 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19143011 Deficiency increases susceptibility to carcinogens and likelihood of developing prostatic cancer.(REVIEW)
19143011 Meta-analysis of gene-disease association. (HuGE Navigator)
19131562 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19124514 No significant, main-effect assocaitions were seen with a homozygous deletion of the GSTT1 polymorphism in colorectal neoplasms.
19124514 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19124497 Meta-analysis of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19117770 Patients with urinary bilharziasis and GSTM1-ve and T1-ve genes might be at increased risk of bladder cancer.
19117770 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19115684 The presence of GSTT1*0 increased the risk for uterine cervix adenocarcinoma development while the allele GSTT1 had a protective action
19115684 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19114965 Glutathione S-transferase profile does not exert an important impact on the influence of tobacco smoking on cancer risk.
19114965 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19103108 Interaction existed in genetic polymorphisms of GSTT1 and serum organochlorine residues.
19103108 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19102712 Polymorphisms in GSTM1 and GSTT1 genes are risk factors for coronary artery disease (CAD) in Type 2 diabetic patients, especially among smokers.
19102712 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19102379 There are no relationship between GSTT1 and GSTM1 gene deletions and hepatic damage caused by HBV.
19102379 Observational study of gene-disease association. (HuGE Navigator)
19086569 Meta-analysis of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19074750 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19062541 Observational study of genotype prevalence. (HuGE Navigator)
19057715 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19057702 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19055448 These results suggest that GST polymorphisms may be a susceptibility factor to smoking-related CAD in the Chinese population.
19055448 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19051221 GST-T1 gene polymorphisms do not confer increased susceptibility to tardive dyskinesia in patients with schizophrenia but TD severity might be related to GST-P1
19051221 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19032232 Observational study of gene-disease association. (HuGE Navigator)
19027952 Frequencies of polymorphic variants of RAD51, XRCC3, NQO1, GSTA1, GSTM1, GSTT1, CYP3A4 and XPD enzymes were similar in patients and controls.
19027952 Observational study of gene-disease association. (HuGE Navigator)
19026998 Observational study of genetic testing. (HuGE Navigator)
19024313 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19017460 The GSTT1 gene is not associated with COPD.
19017460 Meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
19012698 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19009239 the presence of null genotype of GSTT1 taken together with CYP1A1 (Val/Val) genotype increases the susceptibility to Lung cancer
19009239 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19005482 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18993042 Three isoforms of glutathione-S-transferase (GST M1, P1 and T1), have showed an association between GST M1 null, and GST M1 and T1 double null polymorphisms with increased mortality in control group.
18993042 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18992148 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18990750 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18990742 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18986377 Observational study of gene-disease association. (HuGE Navigator)
18979064 the null genotype for the GSTT1 gene and the A/G and G/G variants of the CYP1A1 gene may contribute to the development of bladder cancer.
18979064 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18976645 Observational study of gene-disease association. (HuGE Navigator)
18952980 GSTM1 and GSTT1 polymorphisms may predict adverse events, including cognitive impairment after therapy, in patients with medulloblastoma
18952980 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18950733 Coronary heart disease patients have an increased incidence of both GSTM and GSTT null polymorphisms.
18950733 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18850183 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18840420 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18839526 The polymorphisms of GSTT1 and GSTM1 were not associated with arsenic metabolism level.
18839526 Observational study of gene-disease association. (HuGE Navigator)
18836923 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18834935 maternal genetic polymorphisms of GSTM1 and GSTT1 may modify the oxidative stress by maternal exposure to Environmental tobacco smoking(ETS).
18834935 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18816171 GST and mEPHX variants share a positive association with viral-related hepatocellular carcinoma risk in Indian population.
18816171 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18779738 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18778871 A low GSTT1 null frequency was observed among persons smoking for more than 40 years.
18774560 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18768784 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18768514 Variants of the GSTT1 gene may modify the association between genital talc use and risk of total and serous invasive ovarian cancer.
18768514 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18768509 GSTT1 polymorphisms were not associated with an earlier age of onset for colorectal neoplasms.
18768509 Observational study of gene-disease association. (HuGE Navigator)
18760837 cumulative incidence of relapse was significantly lower and event-free survival was significantly higher in acute myeloid leukemia patients with the GSTT1-present genotype
18760837 Observational study of gene-disease association. (HuGE Navigator)
18725054 Diabetics with null GSTT1 genotypes are substantially at higher risk for developing complications.
18725054 Observational study of gene-disease association. (HuGE Navigator)
18720901 Observational study of genotype prevalence. (HuGE Navigator)
18713495 Meta-analysis of gene-disease association. (HuGE Navigator)
18706519 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18698632 A significantly increased risk of oral clefts was observed among children with the GSTT1 null genotype whose mothers were exposed to environmental tobacco smoke.
18698632 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18690546 polymorphisms may be associated with bladder cancer
18690546 Observational study of gene-disease association. (HuGE Navigator)
18683505 Observational study of gene-disease association. (HuGE Navigator)
18666559 distribution of homozygous deletions in GSTM1 and T1 in the examined groups is significantly heterogeneous
18666559 Observational study of genotype prevalence. (HuGE Navigator)
18666253 Double-null genotype for GSTT1 and GSTM1 might play role in susceptibility to develop drug-induced liver injury, as general mechanism that occurs regardless of type of drug involved, and predominantly in women.
18666253 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18645668 Observational study of gene-disease association. (HuGE Navigator)
18642288 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18642130 serum levels of testosterone and gonadotrophins were not significantly different between smoker and non-smoker males in both null and present GSTT1 genotypes
18642130 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18641537 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18630481 GSTT1 status had no significatn influence on survival of patients with colorectal cancer.
18630481 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18630123 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18628429 GSTM1/GSTT1-double null genotype may be a risk factor for nasopharyngeal carcinoma among males in southern China.
18628429 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18618215 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18610829 polymorphic variants of genes GSTT1, GSTM1, NAT2 and MTRR can modulate the risk of childhood acute leukemia, residents of European part of Russia.
18610829 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18608187 Observational study of gene-disease association. (HuGE Navigator)
18601742 Observational study of gene-disease association. (HuGE Navigator)
18597073 Modulation of the GSTT1 activity by the GSTM1 phenotype in a sample of Italian farm-workers is reported.
18597073 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18594869 among children with steroid-sensitive nephrotic syndrome there is an association with response to cyclophosphamide therapy and combination of GSTP1 Val105 polymorphism and the null genotypes of GSTT1 and GSTM1
18594869 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18593984 Observational study of gene-disease association. (HuGE Navigator)
18591888 GSTT1 and GSTM1 null genotypes are weak, yet possible, modifiers of the risk of papillary thyroid cancer.
18591888 Observational study of gene-disease association. (HuGE Navigator)
18590468 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18589596 CYP1A1 heterozygous mutation and homozygous mutation combined with GSTT1 null genotypes in mothers could increase the risk of preterm delivery.
18589596 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18583868 GSTM1/T1 null genotype contributed to the pathogenesis of smoking-related coronary artery disease to some degree
18583868 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18581889 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18580952 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18577398 GSTT1 can modify the effect of cord blood cotinine on early child neurodevelopment especially for language and fine motor development.
18577398 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18574688 Germline genetic polymorphisms in GSTT1 is associated with breast cancer.
18574688 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18573513 there is no significant difference in the allelic variants in GSTM1 between oral submucous fibrosis and normal, while GSTT1 null gene showed significantly higher frequencies in this precancerous condition
18572765 89.8% PC patients have a mutation in one of the genes GSTT1, GSTM1 or GSTP1.
18572765 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18569591 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18569587 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18566013 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18559562 The GSTT1 genotype was related to the level and dose-related production of S-phenylmercapturic acid.
18559562 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18550589 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18544910 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18544563 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18542066 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18521819 The only significant association between increased risk of breast cancer development and GSTs polymorphsims is found when GSTT1 null, GSTM1 null and the presence of valine in GSTP1 in codon 105 are combined.
18521819 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18507060 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18507050 CYP1A1, GSTM1 and GSTT1 polymorphisms do not appear to influence the genetic susceptibility to OSCC or the progression to more advanced stages.
18507050 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18503826 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18496134 Genome-wide association study of gene-disease association. (HuGE Navigator)
18495522 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18493876 There were no statistically significant differences between myelodysplastic syndrome cases and controls for the GSTM1, GSTT1 and GSTP1 Ile105Val genotype frequencies
18493876 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18492019 Association between combinations of glutathione-S-transferase M1, T1 and P1 genotypes and non-alcoholic fatty liver disease.
18492019 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18491076 Analysis of GSTT1 gene polymorphisms suggests age-related relationships in a northern Italian population.
18491076 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18472644 The GSTT1 -/- genotype along with stage was significantly associated with overall survival and found to be an independent prognostic factor for shorter lung cancer survival.
18472644 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18463401 GSTT1-null genotype was moderately associated with small cell lung cancer risk.
18463401 Meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
18461673 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18455004 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18449862 Observational study of gene-disease association. (HuGE Navigator)
18449058 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18447907 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18444911 The GSTT1 null genotype was not associated with acute lymphoblastic leukemia in Filipino children.
18444911 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18443805 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18425393 CYP1B1, GSTM1, GSTT1 and GSTP1 polymorphisms may have a role in susceptibility to breast cancer
18425393 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18416133 Null genotype frequency of GSTT1 in cancer patients was higher than in healthy subjects. It was still higher in metastatic cancer disseminated to the regional lymph nodes as compared with localized tumor.
18416133 Observational study of gene-disease association. (HuGE Navigator)
18415801 different combinations of GSTP1, GSTM1 and GSTT1 polymorphisms do not greatly increase risk of lung cancer
18415801 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18414197 Genetic polymorphisms of metabolic enzymes CYP1A1, CYP2D6, GSTM1 and GSTT1 and leukemia susceptibility.
18414197 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18413200 Observational study of gene-disease association. (HuGE Navigator)
18409821 Observational study of gene-disease association. (HuGE Navigator)
18398695 used unconditional logistic regression analysis with GSTM1, GSTT1, and GSTO2 genotypes as predictor factors
18398695 Observational study of gene-disease association. (HuGE Navigator)
18397238 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18394656 Chromosomal aberrations in tire plant workers were higher in subjects with GSTT1-null genotype
18394656 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18392488 The GSTM1 gene was deleted in 40% of the cancers and in 44.4% of controls (OR = 1.20; CI 95% 0.70 - 2.04; p=0.5659) while the GSTT1 gene was deleted in 20% and 19.5%, respectively (OR = 0.73; CI 95% 0.37-1.44; p=0.4124).
18392488 Observational study of gene-disease association. (HuGE Navigator)
18387669 Polymorphisms of CuZn-SOD, MnSOD, GSTM1 and GSTT1 in the placental tissue were not associated with preeclampsia.
18387669 Observational study of gene-disease association. (HuGE Navigator)
18385010 Observational study of genetic testing. (HuGE Navigator)
18365908 GSTT1*0 alone and in combination with GSTM1*0 and GSTP1 variant genotypes is a risk factor for gastric neoplasms in the Indian population.
18365908 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18365755 The aim of the study was to investigate NAT1, NAT2, GSTM1, GSTT1, GSTP1, SULT1A1, XRCC1, XRCC3 and XPD genetic polymorphisms, coffee consumption and risk of bladder cancer (BC) through a hospital-based case-control study.
18365755 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18334963 The overall results indicate a possible variable association between various GSTT1 and GSTM1 genotypes and glaucoma in this population.
18334963 Observational study of gene-disease association. (HuGE Navigator)
18328165 The GSTT1 null genotype seems to be involved in polyarticular and systemic juvenile idiopathic arthritis.
18328165 Observational study of gene-disease association. (HuGE Navigator)
18327668 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18325667 It is supposed that chronic exposure to natural sour gas may positively associated with DNA strand breaks and apoptosis in brain, especially in GSTT1 null genotype persons; finally living in the contaminated areas of MIS is associated with high BDI score.
18325667 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18320229 Taken together, maternal smoking significantly increased the risk of preterm delivery (PTD) among women with high-risk CYP1A1 and GSTT1 genotypes. Such joint associations were strongest among PTD accompanied by histologic chorioamnionitis.
18320229 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18308775 There is an association between the appearance of chronic antibody-mediated renal allograft rejection and the occurrence of de novo production of anti-GSTT1 antibodies; this suggest potential role of GSTT1 system in anti-graft immune response
18305556 Observational study of gene-disease association. (HuGE Navigator)
18303971 Gene variants should be analyzed in African-American and Hispanic subjects to increase the predictive capacity of genetic tests.
18303971 Observational study of genotype prevalence. (HuGE Navigator)
18300949 The risk of hypertension was significantly increased in the GSTA1*B allele carriers having also the GSTM1 null genotype or both the GSTM1 and GSTT1 null genotypes.
18300949 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18298341 The V allele of the GSTP1 may be a risk factor for late-onset Alzheimer's disease, mainly in the presence of the apoE 4 allele, while the presence of GSTT1 may indicate protection against the disease
18298341 Observational study of gene-disease association. (HuGE Navigator)
18287869 studied the association of polymorphisms of cytochrome P450 (CYP-4501A1*2A, *2B, *2C and *4 alleles, CYP-4502D6*4 allele), GSTM1 and GSTT1 null genotypes, and NAT2*6B and *7A alleles with the incidence of AML in an eastern Indian population
18287869 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18285692 Observational study of gene-disease association. (HuGE Navigator)
18280004 genetic polymorphism does not contribute to lung cancer risk in Brazilian population
18280004 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18254710 association of the GST T1 null polymorphism with erythrocyte sodium-lithium countertransport activity
18254710 Observational study of gene-disease association. (HuGE Navigator)
18242955 an increased frequency of GSTT1-antibodies in patients with autoimmune diseases compared to healthy controls
18224491 Observational study of gene-disease association. (HuGE Navigator)
18214047 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18207572 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18203021 gene polymorphisms in CYP1A1, GSTT1, GSTP1, GSTM1, and NQO1 were characterized in Saudi individuals with a diagnosis of DLBCL; CYP1A1, GSTT1, GSTP1 demonstrated significant association of DLBCL risk; GSTM1 and NQO1 did not.
18203021 Observational study of gene-disease association. (HuGE Navigator)
18199464 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18197300 Genetic polymorphisms in GSTT1 genes were significant predictors of both baseline and postshowering blood trihalomethane (THM) concentrations as well as of changes in THM concentrations associated with showering
18186040 significant difference in GSTT1 genotype frequency between patients with METH psychosis and controls; the frequency (66.0%) of the GSTT1 null genotype among prolonged-type METH psychotic patients with spontaneous relapse was significantly higher
18186040 Observational study of gene-disease association. (HuGE Navigator)
18177825 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18163994 Oxidative damage may be the cause of infertility in patients with varicocele, and GSTT1 null genotype predisposes to over oxidative damage to sperm of infertile patients with varicocele.
18163994 Observational study of gene-disease association. (HuGE Navigator)
18162130 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18161889 Observational study of gene-disease association. (HuGE Navigator)
18155166 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18097510 GSTT1 null genotype is a predisposing risk factor for sporadic idiopathic azoospermia or oligospermia in northwestern China
18094897 Observational study of gene-disease association. (HuGE Navigator)
18093316 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18093316 The biotransformation enzymes GSTM1, GSTP1 and EPHX1 may modify the effect of dietary factors on the risk of developing colorectal carcinoma and adenoma.
18090121 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18090121 Glutathione-S-transferase T1 and M1 and cytochrome P1A1 genetic polymporphisms do not appear to be a risk factor for cervical disease irrespective of smoking habits.
18080216 Association between GSTT1 gene deletion and sporadic breast cancer in a case-control study.
18080216 Observational study of gene-disease association. (HuGE Navigator)
18078203 Observational study of genotype prevalence and gene-gene interaction. (HuGE Navigator)
18078203 The researchers investigated the GSTT1 null allele in a Mestizo population in Mexico and found a low frequency compared with other populations.
18074677 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18074677 The frequency overall of GSTT1-null genotypes was not significant in HNC patients compared with that of GSTT1-positive genotypes.
18070799 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18067039 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18067039 significant association of null alleles with end stage renal disease
18066575 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18065725 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
18061941 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18061666 Observational study of gene-disease association. (HuGE Navigator)
18058229 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18057098 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18056202 Observational study of genotype prevalence. (HuGE Navigator)
18035413 Overall survival and disease-free survival of CR patients in GSTT1 and GSTM1 double present group was better than in GSTT1- and/or GSTM1-group
18035413 Observational study of gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18035380 Our data have provided evidence that GST polymorphism modifies the susceptibility to HNSCC and have further demonstrated importance of gene-environment interaction in modulating the risk to HNSCC.
18035380 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17996038 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17985662 Observational study of genotype prevalence. (HuGE Navigator)
17980001 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17979505 GSTT1-/GSTM1- genotypes are independent risk factors for development of Type 2 diabetes regardless of the smoking status and these genotypes and current smoking are interactively associated with the incidence of Type 2 diabetes.
17979505 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17965781 Observational study of gene-disease association. (HuGE Navigator)
17953974 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17937745 Observational study of gene-disease association. (HuGE Navigator)
17937745 Among workers frequently exposed to cement in southern Taiwan, those with GST-T1 null genotype had increased risk of chromate sensitization.
17922436 frequencies of GSTM1, GSTT1 and GSTP1 polymorphisms in Dong, Yi and Yao ethnic groups from Guizhou
17922436 Observational study of genotype prevalence. (HuGE Navigator)
17919612 Up-regulation of GSTT1 during aging may be promoted by FSH and H(2)O(2), determined by an in vitro model. CONCLUSION(S): GSTT1 is a good indicator for age-related infertility.
17916905 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17916600 Observational study of genetic testing. (HuGE Navigator)
17914442 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17912498 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17896209 Observational study of gene-disease association. (HuGE Navigator)
17885617 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17880951 Testosterone levels were statistically significantly decreased in male gasoline workers compared with men who had had no occupational exposure to gasoline, which may be relevant to the GSTT1 genotype.
17880951 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17880378 Observational study of genotype prevalence. (HuGE Navigator)
17880378 Determined frequency of GSTT1 polymorphisms in Iranian population.
17879833 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17874314 the GSTT1 polymorphism may be under natural selection because of probably favored ability of GSTT1-active genotype to survival and reproduction.
17874314 Observational study of genotype prevalence. (HuGE Navigator)
17873299 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17869325 Observational study of genotype prevalence. (HuGE Navigator)
17853809 Observational study of genotype prevalence. (HuGE Navigator)
17823442 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17823442 Consumption of cruciferous vegetables was associated with a lower risk of myocardial infarction among those with a functional GSTT1*1 allele, which suggests that compounds that are detoxified by this enzyme contribute to the risk of myocardial infarction
17716707 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17716707 study concludes that the epistatic effect of the GSTT1 and the GSTM1 deletion polymorphism is a risk factor for increased susceptibility to mercury exposure
17711870 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17707637 the significant gene-gene and gene-environment interactions of GST genes may confer a substantial risk to upper aerodigestive tract upper aerodigestive tract cancers in the Tamilian population of south India.
17707637 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17693660 Associations between specific combinations of three GST gene polymorphisms and breast cancer risk but these did not modify the association between cruciferous vegetable intake and breast cancer.
17693660 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17683074 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17659824 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17653748 Distribution of polymorphic variants of GSTT1 gene are not significantly different in young adult and in older patients, which suggests that these factors do not appear the causative factors for HNSCC in young age
17653748 Observational study of gene-disease association. (HuGE Navigator)
17653713 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17653713 glutathione S-transferase theta 1 (GSTT1) genotypes do not influence the risk for Multiple Myeloma
17651144 Observational study of gene-disease association. (HuGE Navigator)
17646057 Observational study of gene-disease association. (HuGE Navigator)
17646057 for esophageal and gastric adenocarcinomas, no consistent patterns of elevated risk were associated with the null GSTT1 genotypes
17644396 Observational study of gene-disease association. (HuGE Navigator)
17644396 GSTT1 polymorphisms on genotoxic effects induced by tobacco smoke
17631926 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17617661 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17617021 Observational study of gene-disease association. (HuGE Navigator)
17611777 GSTT1 polymorphism is not associated with the risk of head and neck cancer
17611777 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17610937 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17603900 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17602170 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17601350 Observational study of gene-disease association. (HuGE Navigator)
17592232 Observational study of gene-disease association. (HuGE Navigator)
17592232 Functional GSTT-1 phenotypes do not correlate with susceptibility to or severity of acute pancreatitis in a patient population from Pittsburgh, Pa., USA.
17586054 Observational study of gene-disease association. (HuGE Navigator)
17581325 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17581325 This case-control study suggests a contribution of CYP2D6 and GSTM1 null variants in the development of acute leukaemia. In addition, GSTM1 and GSTT1 genotypes were apparently related to response, side effects and prognosis of patients with AML.
17572208 Observational study of gene-disease association. (HuGE Navigator)
17572208 A functional GSTT1 polymorphism may be associated with prostate cancer susceptibility in a Caribbean population of African descent.
17569254 Observational study of gene-disease association. (HuGE Navigator)
17568619 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17568619 results suggest that GSTM1, not GSTT1 polymorphism is associated with vitiligo susceptibility in Korean population
17565746 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17565649 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17565649 Null genotypes of GSTT1 is associated with inflammatory bowel diseases.
17563610 Observational study of gene-disease association. (HuGE Navigator)
17536768 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17524385 Observational study of gene-disease association. (HuGE Navigator)
17524385 Results show aggressive periodontitis were associated with the double null of GSTT1 and GSTM1.
17514530 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17514530 GSTM1-null genotype or combination of the GSTM1-null and GSTT1-positive genotypes in females may be associated with increased risk of cataract development in the Turkish population.
17513527 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17513317 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17513317 the AhRR codon 185 and GSTT1 polymorphisms are associated with the risk of advanced stage endometriosis
17507624 Observational study of gene-disease association. (HuGE Navigator)
17505575 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17502835 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17498780 Observational study of gene-disease association. (HuGE Navigator)
17497028 Data have found that GSTT1 null genotype was significantly associated with atopy.
17497028 Observational study of gene-disease association. (HuGE Navigator)
17479278 Observational study of gene-disease association. (HuGE Navigator)
17476458 Observational study of gene-disease association. (HuGE Navigator)
17476458 no significant differences in the distributions of GSTM1 and GSTT1 genotypes between the controls and patients with reflux esophagitis or Barrett's esophagus
17469025 Observational study of gene-disease association. (HuGE Navigator)
17465707 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17454600 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17454600 GSTT1 deletion is associated with follicular non-Hodgkin's Lymphoma
17452905 Observational study of gene-disease association. (HuGE Navigator)
17452905 In liver transplant recipients with a GSTT1 null genotype, the evaluation of "atypical" autoantibodies is useful for monitoring the development of de novo immune hepatitis
17450230 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17449559 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17448506 Observational study of gene-disease association. (HuGE Navigator)
17448506 The GSTT1 positive genotype is associated with an increased mortality for cardiovascular disease.
17445838 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17439673 Observational study of gene-disease association. (HuGE Navigator)
17438538 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17437619 Observational study of gene-disease association. (HuGE Navigator)
17431481 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17428724 Meta-analysis of gene-disease association. (HuGE Navigator)
17428572 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17420047 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17420047 no difference in the frequencies of the GSTM1 null genotype and the combined GSTM1 and GSTT1 null genotypes between patients and controls. Statistical significance was found with GSTT1 null genotype frequency in CML patients as compared to controls
17418613 Observational study of gene-disease association. (HuGE Navigator)
17416773 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17416769 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17412371 Observational study of gene-disease association. (HuGE Navigator)
17408703 Observational study of gene-gene interaction and gene-environment interaction. (HuGE Navigator)
17408703 Smokers carrying GSTT1 deleted genotypes have an increased susceptibility to the smoking related coronary artery disease.
17403528 Observational study of gene-disease association. (HuGE Navigator)
17401013 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17400324 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17397002 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17384900 Observational study of gene-disease association. (HuGE Navigator)
17381051 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17374652 Observational study of gene-disease association. (HuGE Navigator)
17372252 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17367411 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17365577 Observational study of gene-disease association. (HuGE Navigator)
17363580 Observational study of gene-disease association. (HuGE Navigator)
17361553 Observational study of gene-disease association. (HuGE Navigator)
17342328 Observational study of gene-disease association. (HuGE Navigator)
17342328 It is unlikely that polymorphisms of GSTM1, GSTT1 and GSTP1 are general risk factors for melanoma in the Swedish population.
17340208 No association between the GSTT1 polymorphism and bladder cancer incidence.
17340208 Observational study of gene-disease association. (HuGE Navigator)
17336217 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17333241 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17330842 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17318627 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17318621 There was no statistically significant difference in total bilirubin levels in infants with neontal jaundice between patients with the null GSTT1 genotype and those with the wild GSTT1 genotype
17318621 Observational study of gene-disease association. (HuGE Navigator)
17307803 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17307803 GSTM1 null genotype is a risk factor to OSCC among Indian tobacco habits; GSTT1 null genotype, however, emerged as a protective factor.
17307802 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17301692 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17301692 An association between polymorphisms in GSTP1 and ABCB1 and risk of acquiring intratumoral TP53 mutations suggests the existence of putative predisposing genotype backgrounds.
17296590 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17296590 there is no significant association between polymorphisms in CYP3A4, CYP3A5, MDR1, GSTM1 and GSTT1 and outcome either after treatment with induction chemotherapy or after high-dose therapy for multiple myeloma
17291352 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17291352 The results show significant differences between individuals with and without self-reported chemical-related sensitivity with regard to the distribution of NAT2, GSTM1, and GSTT1 gene variants.
17290402 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17290392 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17284320 Observational study of gene-disease association. (HuGE Navigator)
17284320 GSTT1 wildtype and GSTP1 GG are associated with increased risk of skin lesions.
17265526 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17228018 Observational study of gene-disease association. (HuGE Navigator)
17221058 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17221058 In this study the authors were unable to show a correlation between GSTM1 and GSTT1 genotypes and the development of head and neck squamous cell carcinomas in cigarette smokers.
17217536 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17206640 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17195228 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17194620 Observational study of genotype prevalence. (HuGE Navigator)
17194543 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17191090 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17182005 Observational study of gene-disease association. (HuGE Navigator)
17182005 Deletion of GSTT1 gene might be considered as protective factor for hypertension.
17180579 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17178637 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17167268 Observational study of gene-disease association. (HuGE Navigator)
17164366 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17160896 Observational study of gene-disease association. (HuGE Navigator)
17160315 Observational study of gene-disease association. (HuGE Navigator)
17158763 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17158087 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17140374 Observational study of genetic testing. (HuGE Navigator)
17123660 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17119198 Observational study of gene-disease association. (HuGE Navigator)
17119046 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17119046 GSTM1, GSTT1, and GSTP1 are involved in the synergy of alcohol and tobacco in oral, pharyngeal, and laryngeal carcinoma
17118447 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17118447 GSTT1 deletions confers interindividual variability of response to treatment in patients with acute myeloid leukemia
17084623 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17083362 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17078101 Observational study of gene-disease association. (HuGE Navigator)
17072629 Observational study of gene-disease association. (HuGE Navigator)
17071629 Observational study of gene-disease association. (HuGE Navigator)
17069592 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17064856 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17059341 Observational study of gene-disease association. (HuGE Navigator)
17034008 Observational study of gene-disease association. (HuGE Navigator)
17026750 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17022435 Observational study of gene-disease association. (HuGE Navigator)
17020091 Observational study of gene-disease association. (HuGE Navigator)
17016589 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17005168 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17000715 Meta-analysis and HuGE review of gene-disease association and gene-environment interaction. (HuGE Navigator)
16998606 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16995867 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16985033 Observational study of gene-disease association. (HuGE Navigator)
16977512 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16977512 there was no difference in the frequencies of the genotypes of GSTM1 and GSTT1 between chronic obstructive pulmonary disease group and controls, but the GSTP1 Ile/Ile genotype was significantly higher in the patients than in the controls
16977343 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16973661 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16973661 GSTM1 positive genotype and GSTT1 null genotype or the combination of both may be associated with the increased risk of development of primary open-angle glaucoma in the Turkish population
16973168 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16939958 Observational study of gene-disease association. (HuGE Navigator)
16938565 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16938565 null genotypes of GSTM1 and GSTT1 can reduce detoxification capacity of GSTs as members of the xenobiotic enzyme system.
16927413 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16927413 The GSTM1, GSTT1 and GSTP1 gene polymorphisms in diabetic patients and healthy individuals were investigated to test whether polymorphisms in GST genes are associated with diabetes mellitus (DM) in the Turkish population.
16923217 Observational study of gene-disease association. (HuGE Navigator)
16921513 Observational study of gene-disease association. (HuGE Navigator)
16914185 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16911024 Observational study of gene-disease association. (HuGE Navigator)
16906563 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16898590 Observational study of gene-disease association. (HuGE Navigator)
16886896 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16886896 The GSTT1 null genotype, particularly if it is associated with the GSTM1 null genotype, greatly increases the risk for colorectal and gastric cancers.
16884947 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16874663 the localization of GSTT1 in glioblastoma cells can be considered as a possible factor of non-homogeneous chemotherapy response among patients with different GSTT1 genotypes
16870093 Observational study of gene-disease association. (HuGE Navigator)
16869871 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16869871 There is a significant association between the GSTT1 null genotype and rosacea.
16865249 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16864595 Observational study of gene-disease association. (HuGE Navigator)
16847185 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16839232 Observational study of genotype prevalence. (HuGE Navigator)
16837240 Observational study of gene-disease association. (HuGE Navigator)
16830058 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16829689 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16823842 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16823842 No evidence of interaction between the GSTM1 or GSTT1 polymorphisms and smoking, meat intake, green leafy vegetable intake or colorectal cancer.
16798650 Observational study of gene-disease association. (HuGE Navigator)
16788846 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16788422 In our series, the frequencies of GSTM1 and GSTT1 null genotypes did not differ from those of the control subjects.
16788422 Observational study of gene-disease association. (HuGE Navigator)
16788248 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16771603 Observational study of genotype prevalence. (HuGE Navigator)
16765145 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16763966 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16760134 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16760134 To find out the association of GST variants with risk of gallbladder cancer, the distribution of polymorphisms in the GST family of genes (GSTT1, GSTM1, GSTP1, and GSTM3) were studied in 106 cancer patients and 201 healthy controls.
16740387 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16734729 Meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
16721740 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16720291 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16707601 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16703596 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16702390 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16697254 Observational study of gene-disease association. (HuGE Navigator)
16676594 results indicated that both the variation of CYP1A1 gene or GSTT1 -/- genotype alone might not be associated with the susceptibility of acute leukemia while GSTM1 -/- genotype alone or combined with GSTT1 -/- were correlated with ANLL.
16676594 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16638627 Observational study of gene-disease association. (HuGE Navigator)
16631467 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16631467 This study evaluates the combined effects of genetic polymorphisms of GSTM1, GSTT1, and GSTP1 on susceptibility to cervical cancer and interaction of these genes with smoking.
16624155 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16622263 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16621679 The possible links between GSTM1, GSTP1, GSTT1 and NAT2 variants and the frequency of micronuclei (MN) in human lymphocytes, was studied.
16620591 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16620556 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16620396 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16620396 GSTT1 null-genotype is a risk factor for coronary artery disease independent of genotype-smoking interaction.
16618661 Observational study of gene-disease association. (HuGE Navigator)
16618661 GSTT1 genotype appears to be involved in modulation of the risk for head and neck squamous cell carcinoma.
16615268 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16614120 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16614106 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16611538 Observational study of gene-disease association. (HuGE Navigator)
16599007 Observational study of gene-disease association. (HuGE Navigator)
16596290 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16574194 Observational study of gene-disease association. (HuGE Navigator)
16567317 Observational study of gene-disease association. (HuGE Navigator)
16551674 Observational study of gene-disease association. (HuGE Navigator)
16551674 XRCC1, XRCC3, GSTM1 and GSTT1 polymorphisms and chromosome damage are higher in welders than in a control group
16550944 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16536303 gstM1- and gstTl-null genotypes were associated with significantly conspicuous increasing risk of hepatocellular carcinoma.
16536303 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16535827 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16535824 Individuals with the GSTT1 null genotype might be more susceptible to noise induced hearing loss.
16535824 Observational study of gene-disease association. (HuGE Navigator)
16531839 Genetic polymorphisms in the GST genes could slightly modulate arsenic urinary profiles.
16523188 Observational study of gene-disease association. (HuGE Navigator)
16521944 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16520888 Observational study of gene-disease association. (HuGE Navigator)
16517545 Meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
16517545 review of glutathione S-transferase T1 status and gastric cancer risk [meta-analysis]
16509765 Meta-analysis of gene-disease association. (HuGE Navigator)
16507781 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16504378 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16496253 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16496253 The present study suggests that the GSTM1 (null) and GSTT1 (null), GSTM1 (null), and GSTP1 (mutant) combinations may be a genetic risk factor for the development of exudative age-related macular degeneration.
16493615 Observational study of gene-disease association. (HuGE Navigator)
16484137 Observational study of gene-disease association. (HuGE Navigator)
16475728 Observational study of gene-disease association. (HuGE Navigator)
16471212 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16466991 Observational study of gene-disease association. (HuGE Navigator)
16459354 Observational study of gene-disease association. (HuGE Navigator)
16438295 GSTT1 and GSTM1 have no significant effect on the blood dose, measured as Hb adducts over time, after exposure to acrylamide or glycidamide
16427734 Observational study of gene-disease association. (HuGE Navigator)
16424825 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16415899 Observational study of gene-disease association. (HuGE Navigator)
16413497 Observational study of gene-disease association. (HuGE Navigator)
16413497 GSTT1 gene may contribute to the development of T2 DM and may be one of the candidate genes of T2 DM in Chinese population
16409207 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16406813 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16393248 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16390810 Observational study of gene-disease association. (HuGE Navigator)
16386599 Genetic mismatch can be considered a risk factor for de novo autoimmune hepatitis in liver transplantation.
16380991 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16361831 Observational study of genotype prevalence. (HuGE Navigator)
16361831 frequencies of GSTM1, GSTT1, and GSTP1 polymorphisms were evaluated in 1,051 Korean male subjects
16360200 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16357600 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16357593 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16353154 Observational study of gene-disease association. (HuGE Navigator)
16338071 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16338071 genetic polymorphisms of GSTT1, GSTM1, and GSTP1 are not associated with higher risk of esophageal cancer
16321221 Observational study of gene-disease association. (HuGE Navigator)
16318999 Observational study of gene-disease association. (HuGE Navigator)
16318999 The observations do not confirm the effect of the GSTT1 genotype as a risk factor for ischemic cerebrovascular disease, even in smokers.
16316639 Observational study of gene-disease association. (HuGE Navigator)
16314088 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16308270 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16298388 the W234R mutant has a markedly improved catalytic activity with most substrates tested to date compared to the wild-type enzyme, suggesting that humans have gained an evolutionary advantage by a partially disabled active site
16291859 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16284498 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16283344 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16283344 this is the first evidence that the association between the frequencies of GST-M1 and GST-T1 null genotypes & Behcet's disease might be dependent on the interaction of multiple null allele polymorphisms rather than a single null allele of GST-M1 & GST-T1
16282887 Observational study of gene-disease association. (HuGE Navigator)
16235998 Observational study of genetic testing. (HuGE Navigator)
16235982 Observational study of gene-disease association. (HuGE Navigator)
16228113 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16228113 Our study suggests the importance of combined CYP1A1, GSTM1 and GSTT1 polymorphisms in the development of smoking-induced lung cancer.
16227674 Observational study of gene-disease association. (HuGE Navigator)
16227674 impact of the polymorphisms in CYP4501A1 and GSTM1 and GSTT1 genes on the susceptibility and disease severity in 200 patients with aplastic anemia
16214926 Observational study of gene-disease association. (HuGE Navigator)
16199080 Observational study of gene-disease association. (HuGE Navigator)
16195240 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16173971 Observational study of gene-disease association. (HuGE Navigator)
16173036 Observational study of gene-disease association. (HuGE Navigator)
16164441 Observational study of gene-disease association. (HuGE Navigator)
16160620 Observational study of gene-disease association. (HuGE Navigator)
16135950 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16132793 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16132793 Glutathione S-transferase T1 null genotypes did not modify the risk of HCC due to alcohol intake.
16125881 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16124895 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16112301 Observational study and meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
16098500 Observational study of genotype prevalence. (HuGE Navigator)
16097394 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16091114 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16091114 genotype may be important marker for the age of onset and risk of metastasis in oral squamous cell carcinoma
16079101 Observational study of gene-disease association. (HuGE Navigator)
16079101 Low/null activity polymorphisms of this enzyme is not with the risk of developing aplastic anemia in Caucasian patients.
16051638 Observational study of gene-disease association. (HuGE Navigator)
16049806 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16049806 GSTT1 null genotype and who formerly smoked showed an increased breast cancer risk
16047490 Observational study of gene-disease association. (HuGE Navigator)
16043197 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16030123 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16030117 Meta-analysis of gene-disease association. (HuGE Navigator)
16027873 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16020292 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16009381 Observational study of gene-disease association. (HuGE Navigator)
16009381 Role of the metabolic gene polymorphisms in non-smoker lung cancer patients from the International Collaborative Study on Genetic Susceptibility to Environmental Carcinogens.
16005379 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16002077 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16000570 Observational study of gene-disease association. (HuGE Navigator)
15991278 Observational study of gene-disease association. (HuGE Navigator)
15981231 Observational study of gene-disease association. (HuGE Navigator)
15974302 Observational study of genotype prevalence. (HuGE Navigator)
15974302 Finds frequency of GSTT1*0/*0 significantly higher in blacks than in nonblacks in healthy blood donors from a Brazilian mixed population (Rio de Janeiro).
15953982 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15952134 The genetic distribution of the genes in Korean is similar to the distribution of those in Chinese; more than half of the Korean in the study sample lack GSTM1 and GSTT1; the frequency for GSTM1 and GSTT1 null type of Korean is 3 times that of Indian.
15952134 Observational study of genotype prevalence. (HuGE Navigator)
15940757 Observational study of gene-disease association. (HuGE Navigator)
15934438 Observational study of gene-disease association. (HuGE Navigator)
15932176 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15932176 Polymorphisms affecting the activity of the glutathione S-transferase isoform T1 may be associated with the risk of developing chronic severe ethanol liver damage
15932063 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15928955 Observational study of gene-disease association. (HuGE Navigator)
15927971 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15923250 Observational study of gene-disease association. (HuGE Navigator)
15916660 Observational study of gene-disease association. (HuGE Navigator)
15914277 Observational study of gene-disease association. (HuGE Navigator)
15914211 Observational study of gene-disease association. (HuGE Navigator)
15901999 Observational study of gene-disease association. (HuGE Navigator)
15900216 Observational study of gene-disease association. (HuGE Navigator)
15894422 Observational study of gene-disease association. (HuGE Navigator)
15891640 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15891640 We could not demonstrate any significant association between the GSTM1, GSTT1, and GSTP1 polymorphism and age-related hearing loss in this population.
15878757 Observational study of gene-disease association. (HuGE Navigator)
15870154 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
15866637 to determine whether a kidney graft expressing the glutathione S-transferase T1 enzymecould cause an alloimmune response in a recipient with the null GSTT1 genotype that was similar to that observed in liver transplant.
15866612 Observational study of gene-disease association. (HuGE Navigator)
15864623 Observational study of gene-disease association. (HuGE Navigator)
15862746 Meta-analysis of gene-disease association. (HuGE Navigator)
15861041 Observational study of gene-disease association. (HuGE Navigator)
15861041 there is an association between endometriosis and the GSTM1 null deletion, but not with GSTT1 null deletions or the CYP1A1 MspI polymorphism in South Indian women
15849806 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
15845652 Observational study of gene-disease association. (HuGE Navigator)
15840612 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15838728 Observational study of gene-disease association. (HuGE Navigator)
15832776 Observational study of gene-disease association. (HuGE Navigator)
15832776 polymorphisms in the GST genes are associated with increased risk of bladder cancer among Egyptians
15829318 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15805147 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15801491 Observational study of gene-disease association. (HuGE Navigator)
15801482 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15790417 Observational study of gene-disease association. (HuGE Navigator)
15777500 Observational study of gene-disease association. (HuGE Navigator)
15777499 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15770723 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15764300 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15764300 association between genetic polymorphisms of GSTT1, p53 codon 72 and bladder cancer in southern Taiwan
15764294 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15756908 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15748501 The genetic polymorphisms of NQO1, GSTT1 and GSTM1 led to declining of detoxifying ability in benzene metabolism, so the individual with NQO1 C609T T/T genotype, GSTT1 null genotype and GSTM1 null genotype is most susceptive to benzene poisoning.
15748501 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15747169 Observational study of gene-disease association. (HuGE Navigator)
15746160 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15738600 Observational study of gene-disease association. (HuGE Navigator)
15736440 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15734972 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15734960 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15734083 Observational study of gene-disease association. (HuGE Navigator)
15725614 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15725081 Observational study of gene-disease association. (HuGE Navigator)
15721419 Observational study of gene-disease association. (HuGE Navigator)
15719050 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15717164 Observational study of gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15714076 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, gene-gene interaction, gene-environment interaction, pharmacogenomic / toxicogenomic, and healthcare-related. (HuGE Navigator)
15694665 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15688399 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15688399 GSTT1 null genotype is associated with increased gastric cancer risk
15688397 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15668931 Observational study of gene-disease association. (HuGE Navigator)
15668493 Meta-analysis of gene-disease association. (HuGE Navigator)
15667866 Observational study of gene-disease association. (HuGE Navigator)
15661806 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15661231 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15646021 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15642394 Observational study of gene-disease association. (HuGE Navigator)
15642394 Polymorphic in brain cancer.
15640066 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15639977 Observational study of gene-disease association. (HuGE Navigator)
15638917 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15637738 Meta-analysis of gene-disease association. (HuGE Navigator)
15637738 Risks for colorectal cancer are significantly associated with the genetic polymorphisms of GSTT1 deletion, NAT2-rapid acetylator phenotype and genotye and NAT2-rapid acetylator phenotype.
15634519 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15633230 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15633230 Null genotypes are associated with incrwewas risk of hepatocellular carcinoma in southern China.
15627678 Observational study of gene-disease association. (HuGE Navigator)
15616829 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15616829 GSTT1 polymorphisms are associated with prostate cancer susceptibility, especially among smokers.
15612961 Observational study of gene-disease association. (HuGE Navigator)
15612961 GSTT1 and GSTM1 null genotypes and the GSTP1 Val/Val polymorphism may play important roles in asthma pathogenesis.
15588859 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15582598 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15579657 Observational study of gene-disease association. (HuGE Navigator)
15570292 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15565566 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15559321 Observational study of gene-disease association. (HuGE Navigator)
15548945 Observational study of gene-disease association. (HuGE Navigator)
15546237 Observational study of genotype prevalence. (HuGE Navigator)
15546237 Frequency of GSTT1 null allele is significantly higher than reported in Chinese and Japanese populations
15538046 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15536330 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15533900 Observational study of gene-disease association. (HuGE Navigator)
15531593 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15528218 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15526353 Observational study of gene-disease association. (HuGE Navigator)
15526353 Lower frequency of GSTT1 deletion was observed in esophageal adenocarcinoma group compared to controls with a statistically significant difference
15525789 Observational study of gene-disease association. (HuGE Navigator)
15499621 Observational study of gene-disease association. (HuGE Navigator)
15492856 Observational study of gene-disease association. (HuGE Navigator)
15492856 Homozygous deletion of the GSTT1 gene is a risk factor for developing end stage renal sdisease in diabetic patients.
15478298 Observational study of gene-gene interaction and gene-environment interaction. (HuGE Navigator)
15475730 Observational study of gene-disease association. (HuGE Navigator)
15475730 the GSTT1 null genotype may predispose women who are exposed to cigarette smoke during pregnancy to premature delivery
15474467 Observational study of gene-disease association. (HuGE Navigator)
15473001 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15472409 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15472409 Polymorphism of GSTT1 is associated with prostate cancer
15468052 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15459223 Observational study of gene-disease association. (HuGE Navigator)
15459020 Observational study of gene-disease association. (HuGE Navigator)
15455371 Observational study of gene-disease association. (HuGE Navigator)
15450429 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15382273 Observational study of gene-disease association. (HuGE Navigator)
15382272 Observational study of gene-disease association. (HuGE Navigator)
15368334 Observational study of gene-disease association. (HuGE Navigator)
15365959 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15365958 Observational study of gene-disease association. (HuGE Navigator)
15355699 Observational study of gene-disease association. (HuGE Navigator)
15352038 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15342448 Meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
15339690 Observational study of gene-disease association. (HuGE Navigator)
15339690 GSTT1 deletion increrases the risk for MALT lymphoma in a chinese population.
15338373 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15334395 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15333250 Observational study of gene-disease association. (HuGE Navigator)
15333250 the hyperinducible CYP1A1 (T6235C) mutant genotype and its mutants in combination with GSTM1 and GSTT1 null genotypes might represent a risk factor for polycystic ovaries
15327835 Observational study of gene-disease association. (HuGE Navigator)
15319294 Observational study of gene-disease association. (HuGE Navigator)
15315337 Observational study of gene-disease association. (HuGE Navigator)
15309405 GSTT1(null) and GSTP1(val/val) polymorphisms not associated with increased risk of developing Behcet's disease(BD). No relationship between null combination of GSTM1 and GSTT1 genotype polymorphisms and risk of BD.
15302996 Observational study of gene-disease association. (HuGE Navigator)
15300848 GSTT1 copy number in asthmatic pts indicates that deletions could be a risk factor for asthma and GSTT1 might have a protective role in the development of atopic asthma.
15298956 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15288444 Observational study of gene-environment interaction. (HuGE Navigator)
15284178 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15284178 Associations were similar among those with the GSTT1-plus and GSTT1-null genotype in term of consumption of fruit and vegetables.
15279067 Observational study of healthcare-related. (HuGE Navigator)
15273962 Observational study of gene-disease association. (HuGE Navigator)
15258326 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15256483 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15256146 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15246186 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15246186 GSTT1 genotype is associated with increase risk for lung cancer in non-smoking Chinese in Hong Kong.
15226677 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15223862 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15219943 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15215328 Observational study of gene-disease association. (HuGE Navigator)
15215328 polymorphism and susceptibility to cirrhosis or pancreatitis in alcoholics
15213713 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15206494 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15202795 Observational study of genotype prevalence. (HuGE Navigator)
15202795 The frequencies of the GSTT1*0 and GSTT1*B alleles in a Japanese population were found to be 71.1% and 0%, respectively.
15199549 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15197518 Observational study of genotype prevalence. (HuGE Navigator)
15195682 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15195682 nonagenarians and centenarians in good health have a statistically significant difference in the frequency of the GSTT1 deletion and the p53 genotypes when compared to younger controls; possible mechanisms for protection against aging are offered
15195126 Observational study of gene-disease association. (HuGE Navigator)
15194533 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15194533 Polymorphic variants in xenobiotic-metabolism genes including CYP1A1 and GSTT1 may increase the risk of adult AML, particularly when present together.
15194507 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15192016 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15184245 Observational study of gene-disease association. (HuGE Navigator)
15184245 Polymorphisms in GSTT1 genotype may increase risk of lung cancer in light smokers and decrease risk for lung cancer overall in heavy smokers.
15184197 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15182232 Observational study of genetic testing. (HuGE Navigator)
15177667 Observational study of genotype prevalence. (HuGE Navigator)
15177664 Observational study of gene-disease association. (HuGE Navigator)
15165083 Observational study of gene-disease association. (HuGE Navigator)
15148962 Combination of CC16, GSTM1, and GSTT1 genetic polymorphisms is associated with asthma.
15142875 Observational study of gene-disease association. (HuGE Navigator)
15136237 Observational study of gene-disease association. (HuGE Navigator)
15131792 Observational study of gene-disease association. (HuGE Navigator)
15125229 Observational study of gene-disease association. (HuGE Navigator)
15122594 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15120911 Observational study of gene-disease association. (HuGE Navigator)
15120366 Observational study of gene-disease association. (HuGE Navigator)
15115915 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15113959 Observational study of gene-disease association. (HuGE Navigator)
15113959 No significant effects of GSTM1 and GSTT1 genotype on risk were observed in either menopausal group.
15112335 Observational study of gene-disease association. (HuGE Navigator)
15111988 Observational study of genotype prevalence. (HuGE Navigator)
15105047 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15102663 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15099925 Observational study of gene-disease association. (HuGE Navigator)
15099925 No difference is found between Iranian smokers and nonsmokers for glutathione S-transferase T1 genetic polymorphisms.
15095308 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15093273 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15090724 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15090717 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15088107 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15069692 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15069685 Observational study of gene-disease association. (HuGE Navigator)
15069679 Observational study of gene-disease association. (HuGE Navigator)
15066574 Observational study of gene-disease association. (HuGE Navigator)
15066569 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15064808 Observational study of genotype prevalence. (HuGE Navigator)
15061915 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15059587 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15059587 An association was found between GSTT1-null genotype and endometriosis.
15057507 Observational study of gene-disease association. (HuGE Navigator)
15047486 Meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
15047208 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15038404 Observational study of gene-disease association. (HuGE Navigator)
15036125 Observational study of gene-disease association. (HuGE Navigator)
15033463 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15006924 Observational study of gene-disease association. (HuGE Navigator)
15004652 Observational study of gene-disease association. (HuGE Navigator)
14992466 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14991750 Observational study of gene-disease association. (HuGE Navigator)
14980314 Observational study of gene-disease association. (HuGE Navigator)
14980314 findings suggest that the glutathione S-transferase M1 and T1 null mutations are not likely to be associated with an increased risk of endometriosis in a Japanese population
14973092 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
14973088 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
14968442 Observational study of gene-disease association. (HuGE Navigator)
14968442 Polymorphism in GSTM3 may be an important biomarker for prostate cancer risk, especially in the definition of the genetic risk profile of populations of southern Europe.
14963830 Observational study of genotype prevalence. (HuGE Navigator)
14752874 Lack of glutathione S-transferase theta 1 is associated with aplastic anemia and myelodysplastic syndrome
14751678 Observational study of gene-disease association. (HuGE Navigator)
14740231 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14740231 GSTM1 and GSTT1 gene polymorphisms seem to be associated with the development of drug eruption.
14735473 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14726165 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14724908 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
14719475 Observational study of gene-disease association. (HuGE Navigator)
14716779 Observational study of genotype prevalence. (HuGE Navigator)
14714091 Observational study of gene-disease association. (HuGE Navigator)
14714091 The frequency of individual genotypes GSTT1, GSTM1, and GSTP1 and haplotypes in patients with atopic dermatitis and healthy children was studied.
14696128 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14696128 GSTT1 polymorphisms are associated with incomplete intestinal metaplasia in a high-risk area of stomach cancer
14694720 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14693745 Meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
14693733 Observational study of gene-disease association. (HuGE Navigator)
14688020 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14688016 Observational study of gene-disease association. (HuGE Navigator)
14681495 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14669454 Observational study of gene-disease association. (HuGE Navigator)
14666648 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14666648 The absense of the GSTT1 gene is not implicated in susceptibility to lung cancer.
14665706 Observational study of gene-disease association. (HuGE Navigator)
14662420 Observational study of gene-disease association. (HuGE Navigator)
14656945 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14646292 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14644396 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
14643449 Observational study of gene-disease association. (HuGE Navigator)
14637136 Observational study of gene-disease association, gene-gene interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14637136 These findings could indicate the possible protective effect of concurrent presence of GSTM1 and GSTT1 enzymes on the hematopoietic system of filling station workers.
14626895 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
14607752 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14607752 GSTs play an important role in detoxifying the chemotherapeutic agents used to kill leukemia cells. The simultaneous deletion of both the GSTM1 and GSTT1 genes is more predictive than any other parameter of early relapse of childhood B-precursor ALL.
14607333 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14568289 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14562023 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14534704 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
14534704 specific genotype combinations of CYP1A1, GSTM1 and GSTT1 alleles in the development of lung cancer in heavy smokers
14519756 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14504370 Observational study of gene-environment interaction. (HuGE Navigator)
12972061 Observational study of gene-disease association. (HuGE Navigator)
12960134 Observational study of gene-disease association. (HuGE Navigator)
12943165 Observational study of genotype prevalence. (HuGE Navigator)
12926131 Observational study of gene-disease association. (HuGE Navigator)
12883749 Observational study of gene-disease association. (HuGE Navigator)
12883385 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12879272 Observational study of gene-disease association. (HuGE Navigator)
12879272 The GSTT1-0 genotype may have an interaction with carotid atherosclerosis related to rheumatoid arthritis in Korean postmenopausal women without histories of smoking.
12875700 Observational study of gene-disease association. (HuGE Navigator)
12860276 Observational study of gene-disease association. (HuGE Navigator)
12860276 genetic polymorphisms of NAT1 and NAT2 have no independent effect on breast cancer risk, but they modulate breast cancer risk in the presence of GSTM1 and GSTT1 null genotypes.
12859033 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12854128 Observational study of gene-disease association. (HuGE Navigator)
12851839 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12835615 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12827651 Observational study of gene-disease association. (HuGE Navigator)
12827651 There are no associations between the genotypes and the risk of developing acute leukemia.
12814998 Observational study of gene-disease association. (HuGE Navigator)
12814998 There was no association between GSTT1 or GSTP1 genotype and survival in the overall study population, nor in a subgroup of patients treated with chemotherapy.
12814450 Observational study of genotype prevalence. (HuGE Navigator)
12811412 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12811412 smokers with GSTM1 and GSTT1 null genotypes had a significantly higher risk of coronary artery disease than never-smokers with these genotypes present
12794689 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12781423 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12767525 Observational study of gene-disease association. (HuGE Navigator)
12762073 Observational study of gene-environment interaction. (HuGE Navigator)
12760253 Observational study of gene-disease association. (HuGE Navigator)
12760253 Polymorphism of GSTT1 encoding phase 2 xenobiotic dertoxication enzyme was studied.
12759747 Observational study of gene-disease association. (HuGE Navigator)
12759104 Observational study of gene-disease association. (HuGE Navigator)
12750240 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12748560 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12748560 genetic polymorphisms of GSTT1 found in head and neck squamous cell carcinoma.
12747608 Observational study of genotype prevalence. (HuGE Navigator)
12739102 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12736537 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12732844 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12718704 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
12718576 Observational study of genotype prevalence. (HuGE Navigator)
12717779 Observational study of gene-environment interaction. (HuGE Navigator)
12716303 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12713578 Observational study of gene-disease association. (HuGE Navigator)
12690010 Observational study of gene-disease association. (HuGE Navigator)
12682546 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12670526 Observational study of gene-disease association. (HuGE Navigator)
12670526 polymorphisms in GSTT1 is associated with esophageal tumorigenesis
12668919 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12668919 Polymorphism is not associated with laryngeal cancer risk in Caucasians.
12657030 Observational study of gene-disease association. (HuGE Navigator)
12631667 Observational study of gene-disease association. (HuGE Navigator)
12631536 Observational study of gene-environment interaction. (HuGE Navigator)
12624497 Observational study of gene-disease association. (HuGE Navigator)
12620480 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12611461 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12606593 Observational study of gene-disease association. (HuGE Navigator)
12606593 Results suggest that women with glutathione S-transferase M1 but not necessarily T1 null polymorphism may have an increased risk of recurrent pregnancy loss.
12579490 Observational study of genotype prevalence. (HuGE Navigator)
12579334 Observational study of gene-disease association. (HuGE Navigator)
12563680 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12556960 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12556960 alcohol consumption may increase breast cancer risk among those who carry susceptible GST genotypes.
12552997 Observational study of gene-disease association. (HuGE Navigator)
12552971 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12548461 Observational study of gene-disease association. (HuGE Navigator)
12540498 Observational study of gene-disease association. (HuGE Navigator)
12536075 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12530094 Observational study of gene-disease association. (HuGE Navigator)
12524158 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12519635 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12500684 Observational study of gene-disease association. (HuGE Navigator)
12500666 Observational study of gene-disease association. (HuGE Navigator)
12485442 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12460800 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12439221 Observational study of genotype prevalence. (HuGE Navigator)
12439221 detection and characterization of a novel functional polymorphism
12435115 Observational study of genotype prevalence. (HuGE Navigator)
12433731 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12430181 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12430181 Women with the GSTT1 null genotype were found to have a significant 3.15-fold increased risk of breast cancer (95% CI = 1.7-5.8), while GSTM1 and NAT2 genotypes were not associated with breast cancer risk.
12429337 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12421502 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12419832 Observational study of gene-disease association. (HuGE Navigator)
12406553 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12397416 Observational study of gene-disease association. (HuGE Navigator)
12376511 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12365037 Observational study of genotype prevalence. (HuGE Navigator)
12359356 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12355548 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12351375 Observational study of gene-disease association. (HuGE Navigator)
12351375 Deletions have a negative prognostic value in adult acute myeloid leukemia
12296511 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12296511 Women with a GSTT1-null genotype may have an increased risk of breast neoplasms.
12241105 Observational study of gene-disease association. (HuGE Navigator)
12210502 Relationship between GSTT1 polymorphism and susceptibility to colon cancer
12204870 Observational study of gene-disease association. (HuGE Navigator)
12189190 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12183419 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12175548 Observational study of gene-disease association. (HuGE Navigator)
12175533 Observational study of gene-disease association. (HuGE Navigator)
12173466 Observational study of gene-disease association. (HuGE Navigator)
12172927 Observational study of gene-disease association. (HuGE Navigator)
12172391 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, gene-gene interaction, gene-environment interaction, and healthcare-related. (HuGE Navigator)
12171760 Observational study of gene-disease association. (HuGE Navigator)
12170467 Observational study of genotype prevalence. (HuGE Navigator)
12163326 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12163326 GSTT1-null genotype is a risk factors for lung adenocarcinoma development
12153968 Observational study of gene-disease association. (HuGE Navigator)
12153964 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12150456 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12150456 certain null GST genotypes may be associated with an elevated risk of breast cancer and the association may be modified by charred meat intake and cigarette smoking
12145701 No association between GSTT1 genotypes and ALL-L1 susceptibility was found in northern Portuguese children.
12139735 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12091121 Observational study of gene-disease association. (HuGE Navigator)
12083949 Observational study of gene-disease association. (HuGE Navigator)
12083949 Polymorphisms that determine the activity of glutathione transferase GSTT1 appear to significantly influence cutaneous inflammatory reactions after exposure to UV light.
12082022 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12072547 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12072547 association between polymorphism and survival in colorectal cancer
12070010 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12070010 Childhood acute lymphoblastic leukemia was not associated with the GSTT1-null genotype in blacks or whites, in contrast to previous reports.
12063626 Observational study of gene-disease association. (HuGE Navigator)
12055050 Observational study of gene-environment interaction. (HuGE Navigator)
12034316 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12029283 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12018173 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12016165 effect of genotype on sister chromatid exchange induction by styrene in cultured human lymphocytes
12016153 Observational study of gene-disease association. (HuGE Navigator)
12016153 polymorphism of and susceptibility to oral cancer in an Indian population
12010862 Individuals possessing more susceptible non-null GSTT1 genotypes were more likely to reveal p53 overexpression.
12010828 Observational study of gene-disease association. (HuGE Navigator)
12010828 polymorphism related to chronic lymphocytic leukemia
11977425 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11967624 Observational study of gene-disease association. (HuGE Navigator)
11966948 Observational study of gene-disease association. (HuGE Navigator)
11943609 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11936216 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11934439 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11927838 Observational study of gene-disease association. (HuGE Navigator)
11906705 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11898621 Observational study of genotype prevalence. (HuGE Navigator)
11895912 Observational study of gene-disease association. (HuGE Navigator)
11884241 The carcinogenic effects of DCM in humans are caused by the interaction with DNA of a glutathione (GSH) conjugate that is produced by the class theta glutathione S-transferase T1-1 (GST T1-1).
11862323 Observational study of gene-disease association. (HuGE Navigator)
11859435 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11854392 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11844594 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11844594 Genetic determinants of lung cancer short-term survival: the role of glutathione-related genes
11840286 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11825664 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11819818 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11819562 Observational study of gene-disease association. (HuGE Navigator)
11808883 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11792413 patients with carcinoma of the breast and inheritance of a combined gene deletion of GSTM1 and GSTT1 might bear an increased risk to develop a secondary therapy-induced hematologic neoplasia
11779261 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11773866 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11773864 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11766168 Observational study of gene-disease association. (HuGE Navigator)
11760815 Observational study of gene-disease association. (HuGE Navigator)
11757669 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11751442 Observational study of gene-environment interaction. (HuGE Navigator)
11751440 Observational study of genotype prevalence. (HuGE Navigator)
11740339 Observational study of gene-disease association. (HuGE Navigator)
11731429 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11719393 Observational study of gene-disease association. (HuGE Navigator)
11700265 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11692073 Observational study of gene-disease association. (HuGE Navigator)
11675474 Observational study of gene-disease association. (HuGE Navigator)
11641039 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11595069 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11588132 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11585745 Observational study of gene-disease association. (HuGE Navigator)
11564581 Observational study of genotype prevalence, gene-disease association, and gene-gene interaction. (HuGE Navigator)
11562107 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11535253 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11535248 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11525595 Observational study of gene-disease association. (HuGE Navigator)
11520401 Observational study of gene-disease association. (HuGE Navigator)
11511301 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11505167 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11503278 Observational study of gene-disease association. (HuGE Navigator)
11488937 Observational study of gene-disease association. (HuGE Navigator)
11487538 Meta-analysis of gene-disease association. (HuGE Navigator)
11477481 Observational study of gene-disease association. (HuGE Navigator)
11473392 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11470996 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11470992 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11470760 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11459424 Observational study of genotype prevalence. (HuGE Navigator)
11447041 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, gene-environment interaction, and healthcare-related. (HuGE Navigator)
11440964 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11434510 Observational study of gene-disease association. (HuGE Navigator)
11422615 Observational study of gene-disease association. (HuGE Navigator)
11418090 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11410321 Observational study of gene-disease association. (HuGE Navigator)
11408954 Observational study of gene-disease association. (HuGE Navigator)
11406608 Observational study of gene-disease association. (HuGE Navigator)
11389067 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11330960 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11328408 Observational study of gene-disease association. (HuGE Navigator)
11325850 Observational study of gene-disease association. (HuGE Navigator)
11307147 Observational study of gene-disease association. (HuGE Navigator)
11303592 Observational study of gene-disease association. (HuGE Navigator)
11291049 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11283827 Observational study of gene-disease association. (HuGE Navigator)
11279306 Observational study of gene-disease association. (HuGE Navigator)
11275366 Observational study of gene-disease association. (HuGE Navigator)
11259393 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11257276 Observational study of gene-environment interaction. (HuGE Navigator)
11246217 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11234415 Observational study of gene-disease association. (HuGE Navigator)
11230469 Observational study of gene-disease association. (HuGE Navigator)
11191882 Observational study of genotype prevalence. (HuGE Navigator)
11186134 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11186133 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11165755 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11162685 Observational study of gene-disease association. (HuGE Navigator)
11159743 Observational study of gene-disease association. (HuGE Navigator)
11142418 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11131031 Observational study of gene-disease association. (HuGE Navigator)
11097350 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11081456 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11052546 Observational study of gene-gene interaction and gene-environment interaction. (HuGE Navigator)
11051261 Observational study of gene-disease association. (HuGE Navigator)
11045782 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11044240 Observational study of gene-disease association. (HuGE Navigator)
11040079 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
10625170 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, gene-gene interaction, gene-environment interaction, and healthcare-related. (HuGE Navigator)

AA Sequence

MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDGDFTLTESVAI      1 - 70
LLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAEL     71 - 140
DVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEA    141 - 210
HEVILKAKDFPPADPTIKQKLMPWVLAMIR                                            211 - 240
//

Text Mined References (1645)

PMID Year Title
27090234 2016 Association of CYP1A1, GSTM1 and GSTT1 gene polymorphisms with risk of non-small cell lung cancer in Andhra Pradesh region of South India.
26970898 2016 Interactions between CYP2E1, GSTZ1 and GSTT1 polymorphisms and exposure to drinking water trihalomethanes and their association with semen quality.
26823865 2015 Association of GSTs polymorphisms with risk of gestational diabetes mellitus.
26782535 2015 Glutathione S-transferase polymorphisms in varicocele patients: a meta-analysis.
26782376 2015 Polymorphisms of GSTM1, GSTT1, and p53 in Goiânia, Goiás.
26663067 2015 [Association of SPO11 and GST gene polymorphisms with idiopathic male infertility in ethnic Han Chinese].
26656529 2015 GSTM1 and GSTT1 polymorphisms contribute to renal cell carcinoma risk: evidence from an updated meta-analysis.
26604430 2015 Genetic Polymorphisms of Multidrug Resistance Gene-1 (MDR1/ABCB1) and Glutathione S-Transferase Gene and the Risk of Inflammatory Bowel Disease among Moroccan Patients.
26580648 2015 Association between Dietary Patterns and Atopic Dermatitis in Relation to GSTM1 and GSTT1 Polymorphisms in Young Children.
26571237 2015 Glutathione S-Transferase Gene Polymorphisms and Treatment Outcome in Cervical Cancer Patients under Concomitant Chemoradiation.
26552558 2015 GSTA1, GSTM1, GSTP1 and GSTT1 polymorphisms in progressive myoclonus epilepsy: A Serbian case-control study.
26548378 2016 Glutathione S-Transferase M1 and T1 Gene Polymorphisms and the Outcome of Chronic Hepatitis C Virus Infection in Egyptian Patients.
26529288 2015 Genetic polymorphisms in GSTM1, GSTT1 and GSTP1 genes and risk of lung cancer in a North Indian population.
26456689 2015 Modification of the association between maternal smoke exposure and congenital heart defects by polymorphisms in glutathione S-transferase genes.
26435566 2015 Influence of GSTM1, GSTT1, and GSTP1 Polymorphisms on Type 2 Diabetes Mellitus and Diabetic Sensorimotor Peripheral Neuropathy Risk.
26434855 2015 Glutathione S-transferase M1 and T1 Polymorphisms, Cigarette Smoking and HPV Infection in Precancerous and Cancerous Lesions of the Uterine Cervix.
26407578 2016 Relevance of GSTM1, GSTT1 and GSTP1 Gene Polymorphism to Breast Cancer Susceptibility in Mizoram Population, Northeast India.
26406947 2015 Epidemiological factors related to GSTM1 and GSTT1 genes deletion in colon and rectum cancers: A case-control study.
26370772 2015 Glutathione-S-transferases M1/T1 gene polymorphisms and endometriosis: a meta-analysis in Chinese populations.
26350109 2015 Glutathione S-transferase M1 and T1 gene polymorphisms in Brazilian women with endometriosis.
26345960 2015 Predictive potential role of glutathione S-transferase polymorphisms in the prognosis of breast cancer.
26327568 2015 Association of GSTM1 and GSTT1 deletion polymorphisms with Pakistani aplastic anemia patients and controls and meta-analysis.
26295386 2015 Genetic Polymorphisms of Glutathione-Related Enzymes (GSTM1, GSTT1, and GSTP1) and Schizophrenia Risk: A Meta-Analysis.
26244436 2015 Association of Functional Polymorphisms in Matrix Metalloproteinase-9 and Glutathione S-Transferase T1 Genes with Temporomandibular Disorders.
26208492 2015 Is there association between Glutathione S Transferases polymorphisms and cataract risk: a meta-analysis?
26186891 2016 Association of GSTM1, GSTT1, GSTP1-ILE105VAL and ACE I/D polymorphisms with ankylosing spondylitis.
26179485 Are polymorphisms in metabolism protective or a risk for reduced white blood cell counts in a Chinese population with low occupational benzene exposures?
26175060 2015 Associations of common copy number variants in glutathione S-transferase mu 1 and D-dopachrome tautomerase-like protein genes with risk of schizophrenia in a Japanese population.
26163595 2015 Molecular Links between Alcohol and Tobacco Induced DNA Damage, Gene Polymorphisms and Patho-physiological Consequences: A Systematic Review of Hepatic Carcinogenesis.
26158735 GSTM1, GSTT1 and GSTP1 Genetic Variants in Multiple Urologic Cancers.
26150166 2015 Meta-analysis of associations between MTHFR and GST polymorphisms and susceptibility to multiple sclerosis.
26125851 2015 Polymorphisms in GSTM1, GSTT1, GSTP1, and GSTM3 genes and breast cancer risk in northeastern Mexico.
26125819 2015 Pterygium in patients from Goiânia, Goiás, Brazil.
26046920 2015 Meta-Analysis-Based Preliminary Exploration of the Connection between ATDILI and Schizophrenia by GSTM1/T1 Gene Polymorphisms.
26003511 2015 Association between null alleles of GSTM1 and GSTT1 and dependence to heroin and opium.
25923095 Glutathione S-transferase GSTM 1, null genotype may be associated with susceptibility to age-related cataract.
25880856 2015 Relation between glutathione S-transferase genes (GSTM1, GSTT1, and GSTP1) polymorphisms and clinical manifestations of sickle cell disease in Egyptian patients.
25876999 2015 Associations between the polymorphisms of GSTT1, GSTM1 and methylation of arsenic in the residents exposed to low-level arsenic in drinking water in China.
25868597 2015 Glutathione S-transferase T1 and M1 null genotypes and Parkinson's disease risk: evidence from an updated meta-analysis.
25867025 2015 GST M1-T1 null allele frequency patterns in geographically assorted human populations: a phylogenetic approach.
25799091 2015 Polymorphic variants of GSTM1, GSTT1, and GSTP1 genes in childhood acute leukemias: A preliminary study in Argentina.
25790712 2014 [Bronchial hypersensitivity in children with the neutrophilic phenotype of bronchial asthma and GSTM1 and GSTT1 gene polymorphism].
25775823 [Role of gene polymorphisms of phase II of xenobiotic biotransformation from glutathione-S-transferase and N-acetyltransferase families in susceptibility to lung cancer among Mayak workers].
25773389 2015 Genetic variability of glutathione S-transferases influences treatment outcome of breast cancer.
25735346 2015 Genetic susceptibility to oral cancer due to combined effects of GSTT1, GSTM1 and CYP1A1 gene variants in tobacco addicted patients of Pashtun ethnicity of Khyber Pakhtunkhwa province of Pakistan.
25724184 2015 Tobacco carcinogen-metabolizing genes CYP1A1, GSTM1, and GSTT1 polymorphisms and their interaction with tobacco exposure influence the risk of head and neck cancer in Northeast Indian population.
25697264 2015 GSTM1, GSTT1, and NQO1 polymorphisms in cervical carcinogenesis.
25663492 2015 The association of GSTM1 and GSTT1 polymorphisms with squamous cell carcinoma of cervix in Pakistan.
25654087 2015 The effect of CYP, GST, and SULT polymorphisms and their interaction with smoking on the risk of hepatocellular carcinoma.
25646594 2015 Evaluation of Genomic Damage in Peripheral Lymphocytes from Occupationally Exposed Anesthetists: Assessment of the Effects of Age, Sex, and GSTT1 Gene Polymorphism.
25628002 2015 The null polymorphism of the GSTM1/T1 gene is not associated with susceptibility to systemic lupus erythematosus: a meta-analysis.
25549292 2015 Glutathione S-transferase M1 and T1 gene polymorphisms and risk of endometriosis in Tunisian population.
25532576 Association of polymorphisms in glutathione S-transferase genes (GSTM1, GSTT1, GSTP1) with idiopathic azoospermia or oligospermia in Sichuan, China.
25525805 2014 Impact of glutathione S-transferase M1 and T1 on anti-tuberculosis drug-induced hepatotoxicity in Chinese pediatric patients.
25472599 2014 Genetic polymorphisms of glutathione S-transferase M1 and T1, and evaluation of oxidative stress in patients with non-small cell lung cancer.
25461363 2014 Polymorphisms of glutathione S-transferase M1 (GSTM1) and T1 (GSTT1) and endometriosis risk: a meta-analysis.
25445355 2015 Association of paraoxonase (PON)1 activity, glutathione S-transferase GST T1/M1 and STin.2 polymorphisms with comorbidity of tobacco use disorder and mood disorders.
25432134 2015 Association between GSTM1 and GSTT1 polymorphisms and esophageal squamous cell carcinoma: results from a case-control study in Kashmir, India.
25420021 2014 Effects of GSTM1/GSTT1 gene polymorphism and fruit & vegetable consumption on antioxidant biomarkers and cognitive function in the elderly: a community based cross-sectional study.
25408579 2014 Association between glutathione S-transferase T1, M1, and P1 genotypes and the risk of colorectal cancer.
25378345 2015 Glutathione S-transferase M1 and glutathione S-transferase T1 genotype in chronic pancreatitis: a meta-analysis.
25375048 GSTM1, GSTT1 and GSTP1 in patients with multiple breast cancers and breast cancer in association with another type of cancer.
25366778 2014 Association between primary open angle glaucoma and genetic polymorphisms GSTM1/GSTT1 in patients from Goiânia Central-West Region of Brazil.
25358668 2014 Association of glutathione s-transferase gene methylation with risk of schizophrenia in an Iranian population.
25357227 2015 Association of ACE, FABP2 and GST genes polymorphism with essential hypertension risk among a North Indian population.
25348056 2015 Joint effect of glutathione S-transferase genotypes and cigarette smoking on idiopathic male infertility.
25341249 2014 [Assessing the impact of risk factors and polymorphisms GST genes on the development of bronchopulmonary dysplasia in premature infants].
25305053 2014 Genetic modification of the effect of maternal household air pollution exposure on birth weight in Guatemalan newborns.
25263840 2014 The effect of perinatal anxiety on bronchiolitis is influenced by polymorphisms in ROS-related genes.
25251951 Human glutathione S-transferase polymorphisms associated with prostate cancer in the Brazilian population.
25208225 2014 Null genotypes of GSTM1 and GSTT1 and endometriosis risk: a meta-analysis of 25 case-control studies.
25198353 2014 Copy number variation of GSTT1 and GSTM1 and the risk of prostate cancer in a Caribbean population of African descent.
25186055 2014 GST Theta null genotype is associated with an increased risk for ulcerative colitis: a case-control study and meta-analysis of GST Mu and GST Theta polymorphisms in inflammatory bowel disease.
25102096 2014 Glutathione-S-transferase polymorphism and acute lymphoblastic leukemia (ALL) in north Indian children: a case-control study and meta-analysis.
25101770 2014 Role of metabolic genes in blood arsenic concentrations of Jamaican children with and without autism spectrum disorder.
25086621 2014 Null genotype of GSTT1 contributes to increased Parkinson's disease risk in Caucasians: evidence from a meta-analysis.
25040976 2014 Susceptibility of lung cancer with polymorphisms of CYP1A1, GSTM1, GSTM3, GSTT1 and GSTP1 genotypes in the population of Inner Mongolia region.
25036724 2014 The associations between two vital GSTs genetic polymorphisms and lung cancer risk in the Chinese population: evidence from 71 studies.
25027082 2014 Copy number polymorphism of glutathione-S-transferase genes (GSTM1 & GSTT1) in susceptibility to lung cancer in a high-risk population from north-east India.
25015263 2014 Risk modulation of GSTM1–GSTT1 interactions to head and neck cancer in tobacco users.
25010410 2015 Association of GSTM1 and GSTT1 gene polymorphisms and in-vitro fertilisation outcome in a population in northern Iran.
24994605 2014 GSTT1 and GSTM1 polymorphisms predict treatment outcome for acute myeloid leukemia: a systematic review and meta-analysis.
24970787 2014 Effects of glutathione S-transferase M1 and T1 deletions on epilepsy risk among a Tunisian population.
24915237 2014 Interaction effects of long-term air pollution exposure and variants in the GSTP1, GSTT1 and GSTCD genes on risk of acute myocardial infarction and hypertension: a case-control study.
24914957 2014 Does occupational exposure to solvents and pesticides in association with glutathione S-transferase A1, M1, P1, and T1 polymorphisms increase the risk of bladder cancer? The Belgrade case-control study.
24913811 2014 Effect of interaction of glutathione S-transferases (T1 and M1) on the hematologic and cytogenetic responses in chronic myeloid leukemia patients treated with imatinib.
24908960 [Non-specific bronchial hyper-responsiveness and polymorphysm of xenobiotics biotransformation GSTM1 and GSTT1 genes under neutrophilic bronchial asthma in children].
24907267 2014 GSTT1 polymorphism and the risk of developing prostate cancer.
24879623 2014 Glutathione S-transferase T1 null genotype and laryngeal cancer risk: a meta-analysis.
24854448 2014 Association of GSTTI and GSTM1 variants with acute myeloid leukemia risk.
24852428 2014 Interactive effect of glutathione S-transferase M1 and T1 polymorphisms on hepatocellular carcinoma.
24845160 2014 Gene-environment interaction among GSTT1, PON2 polymorphisms and organic solvents on gestational age in a Chinese women cohort.
24840051 Glutathione S-transferase gene polymorphisms (GSTM1, GSTT1, and GSTP1) in Egyptian pediatric patients with sickle cell disease.
24818511 [Evaluation of connection of combinations of polymorphic variants of genes of xenobiotic metabolizing enzymes with a predisposition to lung cancer].
24815471 2014 Glutathione S-transferase T1 and M1 polymorphisms and risk of uterine cervical lesions in women from central Serbia.
24809844 2014 Role of glutathione S transferase polymorphism in COPD with special reference to peoples living in the vicinity of the open cast coal mine of Assam.
24788870 2014 Glutathione-S-transferase M1 and T1 null genotypes are associated with hypertension risk: a systematic review and meta-analysis of 12 studies.
24754249 2016 Polymorphism of GST and FTO Genes in Risk Prediction of Cataract among a North Indian Population.
24732639 2014 Glutathione S-transferase T1 and M1 polymorphisms are associated with lung cancer risk in a gender-specific manner.
24716977 2014 GSTT1 is deregulated in left colon tumors.
24716937 2014 Glutathione-S-transferase polymorphisms (GSTM1, GSTT1 and GSTP1) and acute leukemia risk in Asians: a meta-analysis.
24685594 2014 GSTM1-null and GSTT1-null genotypes are associated with essential arterial hypertension in patients with type 2 diabetes.
24671854 2014 Influence of CYP1A1, GST polymorphisms and susceptibility risk of chronic myeloid leukemia in Syrian population.
24670356 2014 GSTP1, GSTM1 and GSTT1 genetic polymorphisms and total serum GST concentration in stable male COPD.
24640692 2013 [Frequency of gene polymorphic variants (phase II) of biotransformation of GSTT1 and GSTM1 xenobiotics among long-livers (Precarpathian region)].
24637631 2014 Genetic polymorphisms in glutathione-S-transferases are associated with anxiety and mood disorders in nicotine dependence.
24637014 2014 Association of NAT2, GST and CYP2E1 polymorphisms and anti-tuberculosis drug-induced hepatotoxicity.
24605635 [Contribution of genes of xenobiotic detoxification in children with bronchial asthma].
24586676 2014 GSTT1 deletion is related to polycyclic aromatic hydrocarbons-induced DNA damage and lymphoma progression.
24582550 2014 Association between susceptibility to advanced pelvic organ prolapse and glutathione S-transferase P1 Ile105Val polymorphism.
24562622 2014 Ethnic differences in the association of the glutathione S-transferase T1 (GSTT1) null genotype and risk of gastric carcinoma: a systematic review and meta-analysis.
24559168 2014 Glutathione S transferase theta1 and mu1 gene polymorphisms and phenotypic expression of asthma in Egyptian children: a case-control study.
24535908 2014  GSTT1, GSTM1, and GSTP1 polymorphisms as a prognostic factor in women with breast cancer.
24535898 2014 Polymorphisms in the GSTT1 and GSTM1 genes are associated with increased risk of preeclampsia in the Mexican mestizo population.
24535881 2014 Association of the GSTT1 polymorphism in upper aerodigestive tract cancer with tobacco smoking.
24535271 2014 Polymorphisms of methylenetetrahydrofolate reductase and glutathione S-transferase are not associated with the risk of papillary thyroid cancer in Korean population.
24532428 2014 Polymorphisms of glutathione S-transferase M1 (GSTM1) and T1 (GSTT1) in ovarian cancer risk.
24528063 2014 Lack of associations between genetic polymorphisms in GSTM1, GSTT1 and GSTP1 and pancreatic cancer risk: a multi-institutional case-control study in Japan.
24527777 2014 A multiplex polymerase chain reaction method for the simultaneous detection of GSTM1, GSTT1, and GSTP1 polymorphisms.
24508281 2014 Impact of CYP1A1, GSTM1, and GSTT1 polymorphisms in overall and specific prostate cancer survival.
24500512 2013 Polymorphisms of GSTM1 and GSTT1 genes in breast cancer susceptibility: a case-control study.
24460278 2013 Lack of assocation of glutathione S-transferase T1 gene null and susceptibility to lung cancer in china: a meta-analysis.
24460270 2013 Glutathione-S-transferase (GSTM1, GSTT1) null phenotypes and risk of lung cancer in a Korean population.
24453034 2014 Association study of SNPs of genes IFNGR1 (rs137854905), GSTT1 (rs71748309), and GSTP1 (rs1695) in gastric cancer development in samples of patient in the northern and northeastern Brazil.
24411789 2014 The predictive value of GSTT1 polymorphisms in predicting the early response to induction BCG therapy in patients with non-muscle invasive bladder cancer.
24407598 2014 Effects of glutathione S-transferase T1 and M1 deletions on advanced carotid atherosclerosis, oxidative, lipid and inflammatory parameters.
24382428 2014 Association between Glutathione S-transferase M1/Glutathione S-transferase T1 polymorphisms and Parkinson's disease: a meta-analysis.
24381101 2014 Variations in the GST activity are associated with single and combinations of GST genotypes in both male and female diabetic patients.
24375038 2013 Is there any association of glutathione S-transferase T1 (GSTT1) and glutathione S-transferase M1 (GSTM1) gene polymorphism with gastric cancers?
24352702 2014 Meta-analysis of the association of glutathione S-transferase T1 null/presence gene polymorphism with the risk of gastric carcinoma.
24339523 2013 Contribution of GSTM1, GSTT1, and MTHFR polymorphisms to end-stage renal disease of unknown etiology in Mexicans.
24337975 2014 Association of glutathione S-transferase M1, T1, and P1 polymorphisms with renal cell carcinoma: evidence from 11 studies.
24326830 Lung cancer survival and deletion of GSTM1 and GSTT1 genes. A case-series from Spain.
24319713 2013 Role of cytochrome P450-dependent monooxygenases and polymorphic variants of GSTT1 and GSTM1 genes in the formation of brain lesions in individuals chronically exposed to mercury.
24295891 2014 Association of glutathione S-transferase M1/T1 polymorphisms with susceptibility to vitiligo.
24291050 2014 Association of glutathione-S-transferase gene polymorphism and lipoprotein subclasses in hemodialysis patients.
24282086 2014 GSTT1 genetic polymorphism and susceptibility to childhood acute lymphoblastic leukemia: a meta-analysis.
24254297 2014 Polymorphisms of glutathione-S-transferases M1, T1, P1 and susceptibility to colorectal cancer in a sample of the Tunisian population.
24250808 2013 Association of the glutathione s-transferase m1, t1 polymorphisms with cancer: evidence from a meta-analysis.
24216264 2014 Increased level of organochlorine pesticides in chronic kidney disease patients of unknown etiology: role of GSTM1/GSTT1 polymorphism.
24203463 2013 Influence of glutathione S-transferase polymorphisms (GSTT1, GSTM1, GSTP1) on type-2 diabetes mellitus (T2D) risk in an endogamous population from north India.
24194954 2013 GSTM1 and GSTT1 null polymorphisms and childhood acute leukemia risk: evidence from 26 case-control studies.
24189890 2014 Association between glutathione S-transferase T1 null genotype and risk of lung cancer: a meta-analysis of 55 studies.
24124608 2013 GSTT1 copy number gain and ZNF overexpression are predictors of poor response to imatinib in gastrointestinal stromal tumors.
24122206 2014 Association between glutathione S-transferase T1 null genotype and glioma susceptibility: a meta-analysis.
24120392 2014 GSTM1 and GSTT1 gene polymorphisms as major risk factors for bronchopulmonary dysplasia in a Chinese Han population.
24114827 Association of GST null genotypes with anti-tuberculosis drug induced hepatotoxicity in Western Indian population.
24098457 2013 Evaluation of glutathione S-transferase GSTM1 and GSTT1 deletion polymorphisms on type-2 diabetes mellitus risk.
24086370 2013 Impact of glutathione-S-transferases (GST) polymorphisms and hypermethylation of relevant genes on risk of prostate cancer biochemical recurrence: a meta-analysis.
24075358 2013 GSTA1, GSTM1, GSTP1, and GSTT1 polymorphisms and susceptibility to smoking-related bladder cancer: a case-control study.
24072652 2013 A meta-analysis of the relationship between glutathione S-transferase T1 null/presence gene polymorphism and the risk of lung cancer including 31802 subjects.
24053064 2013 The association between gene polymorphisms of glutathione S-transferase T1/M1 and type 1 diabetes in Slovak children and adolescents.
24040330 2013 Glutathione S-transferase T1, O1 and O2 polymorphisms are associated with survival in muscle invasive bladder cancer patients.
24008019 2013 Evaluation of glutathione S-transferase genetic variants affecting type 2 diabetes susceptibility: a meta-analysis.
23982010 2013 Nullity of GSTT1/GSTM1 related to pesticides is associated with Parkinson's disease.
23979980 2014 Quantitative assessment of the influence of glutathione S-transferase T1 null variant on gastric cancer risk.