Property Summary

Ligand Count 35
NCBI Gene PubMed Count 1,428
PubMed Score 1734.76
PubTator Score 1659.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma -1.311 2.9e-03
atypical teratoid / rhabdoid tumor 1.700 1.5e-05
Breast cancer -1.100 8.8e-03
diabetes mellitus -1.100 3.3e-03
glioblastoma 1.200 1.8e-05
lung cancer 1.400 3.8e-03
lung carcinoma -1.300 1.0e-14
medulloblastoma, large-cell 1.300 5.7e-05
ovarian cancer 1.500 3.0e-05
pancreatic ductal adenocarcinoma liver m... 1.701 3.5e-02
psoriasis -1.400 1.2e-04
sonic hedgehog group medulloblastoma 1.100 7.7e-06
tuberculosis 1.200 7.4e-08

Protein-protein Interaction (1)

PDB (63)

Gene RIF (1589)

AA Sequence

MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTIL      1 - 70
RHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGG     71 - 140
KTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ    141 - 210
//

Text Mined References (1440)

PMID Year Title