Property Summary

NCBI Gene PubMed Count 25
PubMed Score 11.72
PubTator Score 11.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -1.112 7.7e-08
Breast cancer -2.800 4.3e-02
breast carcinoma -2.800 5.3e-05
colon cancer -1.600 2.5e-05
ductal carcinoma in situ -1.500 1.8e-03
ependymoma -1.200 9.5e-03
glioblastoma -2.300 1.2e-04
group 3 medulloblastoma -1.700 1.5e-04
intraductal papillary-mucinous adenoma (... -2.400 1.9e-05
intraductal papillary-mucinous carcinoma... -2.700 1.1e-05
intraductal papillary-mucinous neoplasm ... -2.700 4.4e-04
invasive ductal carcinoma -2.026 3.2e-04
lung adenocarcinoma -1.200 1.1e-10
lung cancer -2.600 2.2e-04
lung carcinoma -2.400 2.9e-15
non-small cell lung cancer -1.473 6.8e-23
oligodendroglioma -1.200 4.0e-03
psoriasis -1.400 1.8e-03

Protein-protein Interaction (3)

Gene RIF (13)

AA Sequence

MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKI      1 - 70
TQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSE     71 - 140
FLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFG    141 - 210
KSATWNSK                                                                  211 - 218
//

Text Mined References (25)

PMID Year Title