Property Summary

NCBI Gene PubMed Count 36
PubMed Score 13.74
PubTator Score 20.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Neurodegenerative Disorders 37
Disease Target Count Z-score Confidence
Tinea pedis 30 4.104 2.1

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus -1.200 1.7e-02
psoriasis -1.700 1.7e-04
group 3 medulloblastoma -1.400 2.9e-04
cystic fibrosis -1.088 8.2e-05
glioblastoma 1.100 2.0e-03
ductal carcinoma in situ -1.100 1.2e-02
pituitary cancer 1.200 1.4e-04
dermatomyositis -1.400 5.3e-04

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
602391 confirmatory 5 / 23 / 28 qHTS Assay for Inhibitors of Bacillus subtilis Sfp phosphopantetheinyl transferase (PPTase): SAR in hGST A1-1

Gene RIF (22)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20529827 There were no significant associations between glutathione-S-transferases and p53 expressions and tumor stage, tumor grade and smoking status (p>0.05).
20485444 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20200426 We observed suggestive associations between survival and GSTT1 copy number and GSTA5, GSTM4, and ABCC4 single nucleotide polymorphisms
20200426 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19856098 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19718047 GSTM4 contributes to the cancerous behavior of Ewing's sarcoma.
19584075 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19336475 Observational study of gene-disease association. (HuGE Navigator)
19151192 GSTM4 (glutathione S-transferase mu 4) haplotype 1101000 may be an important determinant for lung function growth
19151192 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18551009 Observational study of gene-disease association. (HuGE Navigator)
17601350 Observational study of gene-disease association. (HuGE Navigator)
16854533 a novel splice variant of GSTM4 that resulted from tandem skipping of exons 4 and 5 is identified.
12140136 Observational study of gene-disease association. (HuGE Navigator)
12140136 A T2517C polymorphism in the GSTM4 gene is associated with risk of developing lung cancer.
11508575 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKI      1 - 70
TQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQ     71 - 140
FLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYT    141 - 210
RVAVWGNK                                                                  211 - 218
//

Text Mined References (38)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20529827 2010 The expression of GST isoenzymes and p53 in non-small cell lung cancer.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20200426 2010 Glutathione pathway genetic polymorphisms and lung cancer survival after platinum-based chemotherapy.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19856098 2010 Genetic variants in GSTM3 gene within GSTM4-GSTM2-GSTM1-GSTM5-GSTM3 cluster influence breast cancer susceptibility depending on GSTM1.
19718047 2009 GSTM4 is a microsatellite-containing EWS/FLI target involved in Ewing's sarcoma oncogenesis and therapeutic resistance.
19584075 2009 Novel susceptibility loci for second primary tumors/recurrence in head and neck cancer patients: large-scale evaluation of genetic variants.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19151192 2009 Variation in the GST mu locus and tobacco smoke exposure as determinants of childhood lung function.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18551009 2008 Glutathione S-transferase variants and hypertension.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
16854533 2006 Screening for inter-individual splicing differences in human GSTM4 and the discovery of a single nucleotide substitution related to the tandem skipping of two exons.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12140136 2002 A T2517C polymorphism in the GSTM4 gene is associated with risk of developing lung cancer.
11508575 2001 Linkage and association analysis of candidate genes in rheumatoid arthritis.
10905636 2000 Identification of mu-class glutathione transferases M2-2 and M3-3 as cytosolic prostaglandin E synthases in the human brain.
10587441 1999 An asparagine-phenylalanine substitution accounts for catalytic differences between hGSTM3-3 and other human class mu glutathione S-transferases.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8471052 1993 Deduced amino acid sequence, gene structure and chromosomal location of a novel human class Mu glutathione S-transferase, GSTM4.
8373352 1993 Molecular cloning and heterologous expression of an alternatively spliced human Mu class glutathione S-transferase transcript.
8349586 1993 Isolation and analysis of the gene and cDNA for a human Mu class glutathione S-transferase, GSTM4.
8284940 1993 Glutathione transferases of classes alpha, mu and pi show selective expression in different regions of rat kidney.
8276420 1993 Chromosomal mapping of the human Mu class glutathione S-transferases to 1p13.
8203914 1994 A comparison of the enzymatic and physicochemical properties of human glutathione transferase M4-4 and three other human Mu class enzymes.
3174634 1988 Hereditary differences in the expression of the human glutathione transferase active on trans-stilbene oxide are due to a gene deletion.
2006920 1991 Structure of human glutathione S-transferase class Mu genes.
1530570 1992 Purification and characterization of eight glutathione S-transferase isoenzymes of hamster. Comparison of subunit composition of enzymes from liver, kidney, testis, pancreas and trachea.