Property Summary

NCBI Gene PubMed Count 145
PubMed Score 93.40
PubTator Score 99.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
malignant mesothelioma -4.300 5.3e-09
osteosarcoma 2.008 1.5e-03
glioblastoma -1.800 1.8e-06
sonic hedgehog group medulloblastoma -1.900 2.8e-06
atypical teratoid / rhabdoid tumor -2.200 3.5e-07
medulloblastoma, large-cell -1.800 2.5e-06
primitive neuroectodermal tumor -1.600 3.0e-05
tuberculosis and treatment for 3 months -1.200 2.3e-03
intraductal papillary-mucinous carcinoma... -2.000 2.7e-03
intraductal papillary-mucinous neoplasm ... -1.100 2.2e-02
colon cancer -2.400 1.7e-02
fibroadenoma 1.100 1.3e-02
diabetes mellitus -1.100 3.2e-02
pediatric high grade glioma -1.500 5.5e-06
psoriasis -1.300 7.1e-25
sarcoidosis -1.100 6.9e-05
invasive ductal carcinoma -1.291 4.0e-03
lung carcinoma 1.600 9.7e-10
Breast cancer -1.300 6.1e-05
acute myeloid leukemia -1.100 3.4e-03
ulcerative colitis -1.400 1.2e-03
ovarian cancer -3.000 6.9e-08
head and neck cancer -1.600 7.8e-03

Synonym

Accession P21266 O60550 Q96HA3
Symbols GST5
GSTB
GTM3
GSTM3-3

Gene

PDB

3GTU  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Protein-protein Interaction (10)

Gene RIF (138)

PMID Text
26125851 No associations between the GSTT1, GSTP1, and GSTM3 genotypes and neoplasia risk were observed. In conclusion, we determined the genotype distribution of GST polymorphisms in control subjects and breast cancer patients from northeastern Mexico.
25193115 NSD1 interacted with RNAPII and bound to GSTM3 -63A/C TATA box.
25040976 To identify the genotypes of CYP1A1, GSTM1, GSTM3, GSTT1 and GSTP1 in a case-control study.
24689813 This meta-analysis suggested that the GSTT1 and GSTM3 polymorphisms might influence osteosarcoma risk.
24416175 This meta-analysis suggests that the GSTM3 A/B polymorphism may be an important protective factor for head and neck cancer, especially of laryngeal cancer and Caucasian populations.
24157827 rs1332018 genetic variants in the GSTM3 promoter predispose the host to downregulating GSTM3 expression in kidney, facilitate carcinogenesis, and predict an unfavourable postoperative prognosis of renal cell carcinoma.
23167362 The GSTM3 A/B gene polymorphism is not associated with lung cancer susceptibility.
23036584 In conclusion, this epistatic interaction showed a high degree of consistency when stratifying by sex, the epsilon4 allele of apolipoprotein E genotype, and geographic region.
22976281 Methylation of GSTM3 promoter may contribute to oxidative stress-associated liver damage and correlate with the disease severity in Acute-on-chronic hepatitis B liver failure.
22430872 All three markers correlated significantly with regional lymph node metastasis: FXYD3 (p = 0.0110), S100A11 (p = 0.0071), and GSTM3 (p = 0.0173) in colon cancer lymphatic metastasis.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21513434 There were no significant differences in distribution of 3-bp deletion polymorphism in intron 6 variant allele in Glutathione-S-transferase M3 between chronic obstructive pulmonary disease patients and controls in a north Indian population.
21072184 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20970553 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20847076 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20661821 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20577141 This study aims to investigate the genotype frequencies of GSTM1, GSTT1 and GSTM3 genes in 80 osteosarcoma patients and 160 normal control participants, and also the influence of these polymorphisms in the clinical outcome of osteosarcoma patients.
20577141 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20549140 In individuals from Angola, Mozambique and the Sao Tome e Principe islands, the GSTM3*B allele was three times more frequent (0.74-0.78) than the GSTM3*A allele (0.22-0.26), with no significant differences in allele frequency across the three groups.
20549140 Observational study of genotype prevalence. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20461808 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20437850 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20391338 Polymorphisms in GSTM1, GSTM3, GSTT1, and GSTP1 do not influence the risk of primary glioma, at least in this population in Rio de Janeiro, Brazil.
20391338 Observational study of gene-disease association. (HuGE Navigator)
20391138 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20200426 Observational study of gene-disease association. (HuGE Navigator)
20136364 Observational study of genetic testing. (HuGE Navigator)
20131310 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20032816 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20029944 Observational study of gene-disease association. (HuGE Navigator)
19922706 The presence of the GSTM3*B allele appears to associated with a reduced risk of laryngeal squamous cell carcinoma.
19922706 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19860743 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19856098 single-nucleotide polymorphisms/haplotypes in the GSTM3 gene within the GSTMs gene cluster are likely to contribute to breast cancer risk when the GSTM1 is absent
19856098 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19822571 The researchers found evidence of an increased risk for non-Hodgkin's lymphoma in women who used hair dye before 1980 and who were carriers of the GSTM3 intron 6 deletion.
19822571 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19786980 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19751749 Observational study of gene-disease association. (HuGE Navigator)
19696791 GST-M3 activity is possibly involved in protection against mucosal atrophy caused by H. pylori as the levels of IgG titer and pepsinogen I are linked to mucosal status.
19696791 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19521675 GSTM1null, GSTM3AB, and CYP2E1c1c2 genotypes modulate the risk of gastric cancer
19521675 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19486347 Observational study of gene-disease association. (HuGE Navigator)
19424794 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19407363 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19339270 Observational study of gene-disease association. (HuGE Navigator)
19336475 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19151192 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19062541 Observational study of genotype prevalence. (HuGE Navigator)
18992148 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18990750 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18850183 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18668224 Our results suggested GSTM3 (AB + BB) genotype to be significantly associated with prostate cancer risk.
18668224 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18569590 The GSTM3*A/*A genotype was 76% in cancer cases versus 74% in controls; a significant association between smoking status and GSTM3 genotype was not detected.
18569590 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18551009 Observational study of gene-disease association. (HuGE Navigator)
18510611 Observational study of gene-disease association. (HuGE Navigator)
18447907 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18423940 Diminished GSTM3 mRNA levels correlated with decreased minichromosome maintenance deficient 3 (MCM3) mRNA levels in a diagnostic and SNP-dependent fashion in Alzheimer disease.
18423940 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18258609 Observational study of gene-disease association. (HuGE Navigator)
18204928 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18177825 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18065725 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
17922434 distribution of -63A/C polymorphism of human glutathione S-transferase M3(GSTM3) gene in Chinese Han population and the association of -63A/C polymorphism with essential hypertension
17922434 Observational study of gene-disease association. (HuGE Navigator)
17904251 Single marker association analyses revealed that the AGG/AGG genotype of the GSTM3 rs1799735 (del/AGG) polymorphism was associated with an increased risk of AD (p=0.05), especially in the group of APOE4-allele non-carriers (p=0.004; OR=2.07).
17904251 Observational study of gene-disease association. (HuGE Navigator)
17716224 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17716224 Polymorphisms affecting GSTP1, GST alpha 1 and GSTM3 genes are probably not related to the risk of developing hepatocellular carcinoma in a population of white Spanish patients.
17617661 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17601350 Observational study of gene-disease association. (HuGE Navigator)
17565746 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17449559 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17372252 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17290392 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17259654 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17220350 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17083362 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17034008 Observational study of gene-disease association. (HuGE Navigator)
16985026 Observational study of gene-disease association. (HuGE Navigator)
16886896 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16765145 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16760134 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16760134 To find out the association of GST variants with risk of gallbladder cancer, the distribution of polymorphisms in the GST family of genes (GSTT1, GSTM1, GSTP1, and GSTM3) were studied in 106 cancer patients and 201 healthy controls.
16598069 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16509765 Meta-analysis of gene-disease association. (HuGE Navigator)
16488179 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16328000 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16172217 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16112301 Observational study and meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
16006997 Observational study of gene-disease association. (HuGE Navigator)
15914277 Observational study of gene-disease association. (HuGE Navigator)
15829318 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15665284 GSTM3 -63C allele strongly affects gene expression and suggests that individuals who carry the low expression allele may be deficient in glutathione transferase catalyzed biological functions.
15654505 Observational study of gene-disease association. (HuGE Navigator)
15621212 Glutathione S-transferase hGSTM3 has a role in ageing-associated neurodegeneration
15525789 Observational study of gene-disease association. (HuGE Navigator)
15459020 Observational study of gene-disease association. (HuGE Navigator)
15338373 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15115915 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15069685 Observational study of gene-disease association. (HuGE Navigator)
14968442 Observational study of gene-disease association. (HuGE Navigator)
14968442 No increased prostate scancer risk for men carrying any of the GSTM1 or GSTT1 genotypes.
14735473 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14634838 Observational study of genotype prevalence. (HuGE Navigator)
12548461 Observational study of gene-disease association. (HuGE Navigator)
12359356 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12063626 Observational study of gene-disease association. (HuGE Navigator)
12016153 Observational study of gene-disease association. (HuGE Navigator)
12016153 polymorphism of and susceptibility to oral cancer in an Indian population
11927838 Observational study of gene-disease association. (HuGE Navigator)
11740339 Observational study of gene-disease association. (HuGE Navigator)
11692073 Observational study of gene-disease association. (HuGE Navigator)
11535247 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11511301 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11408349 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11303592 Observational study of gene-disease association. (HuGE Navigator)
11289100 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11173863 Observational study of gene-disease association. (HuGE Navigator)
11081456 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11040079 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDG      1 - 70
KNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLK     71 - 140
QFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKM    141 - 210
PINNKMAQWGNKPVC                                                           211 - 225
//

Text Mined References (146)

PMID Year Title
26125851 2015 Polymorphisms in GSTM1, GSTT1, GSTP1, and GSTM3 genes and breast cancer risk in northeastern Mexico.
25193115 2014 Role of NSD1 in H2O2-induced GSTM3 suppression.
25040976 2014 Susceptibility of lung cancer with polymorphisms of CYP1A1, GSTM1, GSTM3, GSTT1 and GSTP1 genotypes in the population of Inner Mongolia region.
24689813 2015 The association of glutathione S-transferase polymorphisms in patients with osteosarcoma: evidence from a meta-analysis.
24416175 2014 GSTM3 A/B polymorphism and risk for head and neck cancer: a meta-analysis.
24157827 2013 Genetic variation in the GSTM3 promoter confer risk and prognosis of renal cell carcinoma by reducing gene expression.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23167362 2012 Lack of association of glutathione S-transferase M3 gene polymorphism with the susceptibility of lung cancer.
23036584 2013 Discovery by the Epistasis Project of an epistatic interaction between the GSTM3 gene and the HHEX/IDE/KIF11 locus in the risk of Alzheimer's disease.
22976281 2012 Methylation of the glutathione-S-transferase M3 gene promoter is associated with oxidative stress in acute-on-chronic hepatitis B liver failure.
22430872 2012 Tissue-based proteomics reveals FXYD3, S100A11 and GSTM3 as novel markers for regional lymph node metastasis in colon cancer.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21513434 2011 Association of genetic polymorphism of GSTT1, GSTM1 and GSTM3 in COPD patients in a north Indian population.
21269460 2011 Initial characterization of the human central proteome.
21072184 2010 Flavopiridol pharmacogenetics: clinical and functional evidence for the role of SLCO1B1/OATP1B1 in flavopiridol disposition.
20970553 2010 Toward personalized medicine in renal transplantation.
20847076 2011 Genetic susceptibility to asbestos-related fibrotic pleuropulmonary changes.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20661821 2010 Association of xenobiotic metabolizing enzymes genetic polymorphisms with esophageal cancer in Kashmir Valley and influence of environmental factors.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20577141 2010 Glutathione S-transferase polymorphisms in osteosarcoma patients.
20549140 2010 High prevalence of the GSTM3*A/B polymorphism in sub-Sarahan African populations.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20461808 2010 A case-control study of Parkinson's disease and tobacco use: gene-tobacco interactions.
20437850 Alcohol, tobacco and genetic susceptibility in relation to cancers of the upper aerodigestive tract in northern Italy.
20391338 2010 Lack of association between glutathione S-transferase polymorphisms and primary glioma in a case-control study in Rio de Janeiro.
20391138 2010 Lifestyle, environmental, and genetic predictors of bulky DNA adducts in a study population nested within a prospective Danish cohort.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20200426 2010 Glutathione pathway genetic polymorphisms and lung cancer survival after platinum-based chemotherapy.
20136364 2010 Errors and reproducibility of DNA array-based detection of allelic variants in ADME genes: PHARMAchip.
20131310 2010 Genetic polymorphisms in cytochrome P450s, GSTs, NATs, alcohol consumption and risk of non-Hodgkin lymphoma.
20032816 2010 The GSTP1 Ile105 Val polymorphism modifies the metabolism of toluene di-isocyanate.
20029944 2010 Genetic polymorphisms in the metabolic pathway and non-Hodgkin lymphoma survival.
19922706 2010 GSTT1, GSTM1, GSTM3 and NAT2 polymorphisms in laryngeal squamous cell carcinoma in a Greek population.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19860743 2010 Effect of gene-environment Interactions on mental development in African American, Dominican, and Caucasian mothers and newborns.
19856098 2010 Genetic variants in GSTM3 gene within GSTM4-GSTM2-GSTM1-GSTM5-GSTM3 cluster influence breast cancer susceptibility depending on GSTM1.
19822571 2009 Genetic variations in xenobiotic metabolic pathway genes, personal hair dye use, and risk of non-Hodgkin lymphoma.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19786980 2010 Genetic polymorphisms and the efficacy and toxicity of cisplatin-based chemotherapy in ovarian cancer patients.
19751749 2009 Risk of malignant pleural mesothelioma and polymorphisms in genes involved in the genome stability and xenobiotics metabolism.
19696791 2009 Association between polymorphisms in glutathione S-transferase Mu3 and IgG titer levels in serum against Helicobacter pylori.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19521675 2009 Role of xenobiotic-metabolizing enzyme gene polymorphisms and interactions with environmental factors in susceptibility to gastric cancer in Kashmir Valley.
19486347 Influence of genetic polymorphisms in GSTM1, GSTM3, GSTT1 and GSTP1 on allograft outcome in renal transplant recipients.
19424794 2010 Genetic polymorphisms in phase I and phase II enzymes and breast cancer risk associated with menopausal hormone therapy in postmenopausal women.
19407363 2009 GSTM1, GSTM3 and GSTT1 gene variants and risk of benign prostate hyperplasia in North India.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19151192 2009 Variation in the GST mu locus and tobacco smoke exposure as determinants of childhood lung function.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19062541 2008 [Glutathione-S-transferase gene polymorphism in Russian populations of European Russia].
19060904 2009 An empirical framework for binary interactome mapping.
18992148 2008 Low-penetrance alleles predisposing to sporadic colorectal cancers: a French case-controlled genetic association study.
18990750 2008 Red meat intake, doneness, polymorphisms in genes that encode carcinogen-metabolizing enzymes, and colorectal cancer risk.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18850183 2007 Antioxidant defense markers modulated by glutathione S-transferase genetic polymorphism: results of lung cancer case-control study.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18668224 2009 Association of GSTM3 intron 6 variant with cigarette smoking, tobacco chewing and alcohol as modifier factors for prostate cancer risk.
18569590 2008 The influence of polymorphisms of glutathione S-transferases M1 and M3 on the development of human urothelial cancer.
18551009 2008 Glutathione S-transferase variants and hypertension.
18510611 2008 Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
18447907 2008 Influence of genetic factors on toluene diisocyanate-related symptoms: evidence from a cross-sectional study.
18423940 2010 A GSTM3 polymorphism associated with an etiopathogenetic mechanism in Alzheimer disease.
18258609 2008 A comprehensive analysis of phase I and phase II metabolism gene polymorphisms and risk of non-small cell lung cancer in smokers.
18204928 2008 Vegetables- and antioxidant-related nutrients, genetic susceptibility, and non-Hodgkin lymphoma risk.
18177825 2008 Association of GSTM1, GSTT1, and GSTM3 gene polymorphisms and susceptibility to cervical cancer in a North Indian population.
18065725 2008 Genetic variants of glutathione S-transferase as possible risk factors for hepatocellular carcinoma: a HuGE systematic review and meta-analysis.
17922434 2007 [Association of -63A/C polymorphism of glutathione S-transferase M3 gene with essential hypertension in Chinese population].
17904251 2009 Gene variations in GSTM3 are a risk factor for Alzheimer's disease.
17716224 2007 Glutathione S-transferases pi 1, alpha 1 and M3 genetic polymorphisms and the risk of hepatocellular carcinoma in humans.
17617661 2007 Glutathione S-transferase polymorphisms, cruciferous vegetable intake and cancer risk in the Central and Eastern European Kidney Cancer Study.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17565746 2007 Prospective study of urinary excretion of 7-methylguanine and the risk of lung cancer: Effect modification by mu class glutathione-S-transferases.
17449559 2007 Gene-environment interactions in parkinsonism and Parkinson's disease: the Geoparkinson study.
17372252 2007 An international case-control study of glutathione transferase and functionally related polymorphisms and risk of primary adult brain tumors.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17290392 2007 Polymorphisms of glutathione-S-transferase M1 and manganese superoxide dismutase are associated with the risk of malignant pleural mesothelioma.
17259654 2007 Development of lung cancer before the age of 50: the role of xenobiotic metabolizing genes.
17220350 2007 Role of GSTM3 polymorphism in the risk of developing esophageal cancer.
17083362 2006 Glutathione S-transferase and CYP1A1 gene polymorphisms and non-melanoma skin cancer risk in Italian transplanted patients.
17034008 2007 Glutathione S-transferase polymorphisms and onset age in alpha-synuclein A53T mutant Parkinson's disease.
16985026 2006 Metabolic gene variants and risk of non-Hodgkin's lymphoma.
16886896 2006 Glutathione S-transferases mu 1, theta 1, pi 1, alpha 1 and mu 3 genetic polymorphisms and the risk of colorectal and gastric cancers in humans.
16765145 2006 Pharmacokinetics and toxicity of docetaxel: role of CYP3A, MDR1, and GST polymorphisms.
16760134 Genetic polymorphisms in GSTM1, GSTT1, GSTP1, GSTM3 and the susceptibility to gallbladder cancer in North India.
16598069 2006 Variation in genes relevant to aromatic hydrocarbon metabolism and the risk of adult brain tumors.
16509765 2006 Five glutathione s-transferase gene variants in 23,452 cases of lung cancer and 30,397 controls: meta-analysis of 130 studies.
16488179 2006 Influence of CYP1A1, CYP2E1, GSTM3 and NAT2 genetic polymorphisms in oral cancer susceptibility: results from a case-control study in Rio de Janeiro.
16328000 2006 Polymorphisms in the glutathione S-transferase mu cluster are associated with tumour progression and patient outcome in colorectal cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16172217 2005 Increased risk of oral leukoplakia and cancer among mixed tobacco users carrying XRCC1 variant haplotypes and cancer among smokers carrying two risk genotypes: one on each of two loci, GSTM3 and XRCC1 (Codon 280).
16112301 2005 NAT2 slow acetylation, GSTM1 null genotype, and risk of bladder cancer: results from the Spanish Bladder Cancer Study and meta-analyses.
16006997 2005 A comprehensive analysis of phase I and phase II metabolism gene polymorphisms and risk of colorectal cancer.
15914277 2005 The impact of genetic factors on the incidence of multiple primary tumors (MPT) of the head and neck.
15829318 2005 Polymorphisms in genes involved in xenobiotic metabolism and lung cancer risk under the age of 60 years. A pooled study of lung cancer patients in Denmark and Norway.
15665284 2005 Expression-based discovery of variation in the human glutathione S-transferase M3 promoter and functional analysis in a glioma cell line using allele-specific chromatin immunoprecipitation.
15654505 2005 Association of habitual smoking and drinking with single nucleotide polymorphism (SNP) in 40 candidate genes: data from random population-based Japanese samples.
15621212 2005 Glutathione S-transferase hGSTM3 and ageing-associated neurodegeneration: relationship to Alzheimer's disease.
15525789 The role of polymorphisms of glutathione S-transferases GSTM1, M3, P1, T1 and A1 in susceptibility to alcoholic liver disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459020 2005 Polymorphisms in glutathione S-transferases and non-melanoma skin cancer risk in Australian renal transplant recipients.
15338373 2004 Genetic analysis of the glutathione s-transferase genes MGST1, GSTM3, GSTT1, and GSTM1 in patients with hereditary pancreatitis.
15115915 2004 Glutathione-S-transferase M1, M3, P1 and T1 polymorphisms and severity of lung disease in children with cystic fibrosis.
15069685 2004 Glutathione S-transferase T1 null-genotype is associated with an increased risk of lung cancer.
14968442 2004 Metabolic susceptibility genes and prostate cancer risk in a southern European population: the role of glutathione S-transferases GSTM1, GSTM3, and GSTT1 genetic polymorphisms.
14735473 2004 Glutathione S-transferase M3 (A/A) genotype as a risk factor for oral cancer and leukoplakia among Indian tobacco smokers.
14634838 2003 Allele frequencies of single nucleotide polymorphisms (SNPs) in 40 candidate genes for gene-environment studies on cancer: data from population-based Japanese random samples.
12548461 2003 [First results on the influence of polymorphisms at glutathione S-transferase, cytochrome P450, and tumor necrosis factor gene loci on the development of multiple head and neck cancer].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359356 2002 Microsomal epoxide hydrolase and glutathione S-transferase polymorphisms in relation to laryngeal carcinoma risk.
12063626 2002 [Influence of glutathione s-transferase and cytochrome p450 polymorphisms on prognosis of head and neck cancer].
12016153 2002 Polymorphism at GSTM1, GSTM3 and GSTT1 gene loci and susceptibility to oral cancer in an Indian population.
11927838 2002 N-Acetyltransferase genotypes as modifiers of diisocyanate exposure-associated asthma risk.
11740339 2001 Glutathione-S-transferase M1, M3, T1 and P1 polymorphisms and susceptibility to non-small-cell lung cancer subtypes and hamartomas.
11692073 2001 Glutathione S-transferase genotypes and stomach cancer in a population-based case-control study in Warsaw, Poland.
11535247 2001 Influence of polymorphisms of the human glutathione transferases and cytochrome P450 2E1 enzyme on the metabolism and toxicity of ethylene oxide and acrylonitrile.
11511301 2001 Polymorphisms in glutathione S-transferases are associated with altered risk of nonmelanoma skin cancer in renal transplant recipients: a preliminary analysis.
11408349 2001 Glutathione-S-transferase gene polymorphisms in colorectal cancer patients: interaction between GSTM1 and GSTM3 allele variants as a risk-modulating factor.
11303592 2001 Glutathione S-transferase M1, M3, P1, and T1 genetic polymorphisms and susceptibility to breast cancer.
11289100 2001 A case-control study of microsomal epoxide hydrolase, smoking, meat consumption, glutathione S-transferase M3, and risk of colorectal adenomas.
11173863 2000 Susceptibility genes: GSTM1 and GSTM3 as genetic risk factors in bladder cancer.
11081456 2000 Glutathione S-transferase genetic polymorphisms and individual sensitivity to the ototoxic effect of cisplatin.
11040079 2000 Polymorphic glutathione S-transferase M1 is a risk factor of primary open-angle glaucoma among Estonians.
10587441 1999 An asparagine-phenylalanine substitution accounts for catalytic differences between hGSTM3-3 and other human class mu glutathione S-transferases.
10037815 1999 Combining SSH and cDNA microarrays for rapid identification of differentially expressed genes.
9882431 1999 Distinctive structure of the human GSTM3 gene-inverted orientation relative to the mu class glutathione transferase gene cluster.
9797707 1998 Characterisation of xenobiotic-metabolising enzyme expression in human bronchial mucosa and peripheral lung tissues.
9545290 1998 Rationale for reclassification of a distinctive subdivision of mammalian class Mu glutathione S-transferases that are primarily expressed in testis.
9230131 1997 Subunit diversity and tissue distribution of human glutathione S-transferases: interpretations based on electrospray ionization-MS and peptide sequence-specific antisera.
8824514 1996 Allelism at the glutathione S-transferase GSTM3 locus: interactions with GSTM1 and GSTT1 as risk factors for astrocytoma.
8473333 1993 A basis for differentiating among the multiple human Mu-glutathione S-transferases and molecular cloning of brain GSTM5.
8404061 1994 Chromosome assignment of the human glutathione S-transferase mu 3 gene (GSTM3) to chromosome 1 by gene specific polymerase chain reaction.
8373352 1993 Molecular cloning and heterologous expression of an alternatively spliced human Mu class glutathione S-transferase transcript.
8317488 1993 Identification of class-mu glutathione transferase genes GSTM1-GSTM5 on human chromosome 1p13.
8242618 1993 Immunohistochemical localization of glutathione S-transferases in human lung.
8218382 1993 Human Mu-class glutathione S-transferases present in liver, skeletal muscle and testicular tissue.
2345169 1990 A distinct human testis and brain mu-class glutathione S-transferase. Molecular cloning and characterization of a form present even in individuals lacking hepatic type mu isoenzymes.
1530570 1992 Purification and characterization of eight glutathione S-transferase isoenzymes of hamster. Comparison of subunit composition of enzymes from liver, kidney, testis, pancreas and trachea.