Property Summary

Ligand Count 35
NCBI Gene PubMed Count 57
PubMed Score 166.12
PubTator Score 138.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 1.5e-26

Protein-protein Interaction (3)

PDB (11)

Gene RIF (32)

AA Sequence

MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKI      1 - 70
TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQ     71 - 140
FLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFT    141 - 210
KMAVWGNK                                                                  211 - 218
//

Text Mined References (61)

PMID Year Title