1. Home
  2. Targets
  3. transfer/carrier protein
  4. Glutathione S-transferase kappa 1

Tchem Glutathione S-transferase kappa 1

Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB).

This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jan 2009]

 Comments

Property Summary

NCBI Gene PubMed Count 32
PubMed Score 10.33
PubTator Score 2053.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.100 8.6e-04
malignant mesothelioma -1.300 2.0e-06
osteosarcoma -1.570 1.2e-04
glioblastoma 1.600 2.4e-04
tuberculosis 1.600 1.0e-09
subependymal giant cell astrocytoma 1.454 1.7e-02
ovarian cancer 2.200 7.9e-07

Synonym

Accession Q9Y2Q3 B4DIH1 B4DSY2 Q6P4H0 Q7Z520 Q9P1S4
Symbols GST
GST13
hGSTK1
GSTK1-1
GST13-13
GST 13-13

Gene

GSTK1

PANTHER Protein Class (1)

PDB

1YZX   3RPN   3RPP  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

 UniProt Keyword (7)

 GO Function (4)

 GO Component (7)

 GO Process (3)

 Compartment GO Term (30)

See all...

 MGI Phenotype (7)

 HCA RNA Cell Line (56)

See all...

Pathway (13)

See all...

Protein-protein Interaction (5)

HSPD1   PAG1   LIMA1   PPP2R2D   TK2  

Drug (1)

Structure of glutathione

glutathione
pIC50 7.70

Ligand (1)

Structure of CHEMBL1543

CHEMBL1543
pIC50 7.70

Gene RIF (14)

PMID Text
25739441 DsbA-L is localized in both the mitochondria and the endoplasmic reticulum (ER) in adipocytes; its ER localization plays a critical role in suppressing ER stress and promoting adiponectin biosynthesis and secretion.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of glutathione S-transferase kappa 1 (GSTK1) expression by HIV-1 Vpr in Vpr transduced macrophages
23426619 we have optimized the GST-Nck1-SH2 pull-down procedure to obtain tyrosine-phosphorylated proteins in tumor tissues
23330092 drug resistance in three strains of tumor cells is associated with significant increase in hGSTP1 and hGSTA4 gene expression, whereas increased hGSTK1 gene expression was detected only in resistant erythroleukemia and mammary adenocarcinoma cells.
20472488 This study does not give evidence of interaction between the GST polymorphisms and smoking may although this study provided sufficient statistical power to detect modest interaction.
19639233 The objective of this study was to investigate the molecular mechanisms underlying Group B Streptococcus-human umbilical vein endothelial cells interaction, focusing specifically on the responsiveness of host protein tyrosine kinase (PTK).
19225211 SNP-1308G/T (rs1917760) genotypes of DsbA-L gene might participate in insulin secretion and body fat distribution. It is possible that polymorphisms of DsbA-L gene associated with metabolic diseases[DsbA-L]
19225211 Observational study of gene-disease association. (HuGE Navigator)
18774560 Our results suggest that genetic polymorphisms of xenobiotic-metabolizing enzymes could play an important role in infertility.
17601350 Observational study of gene-disease association. (HuGE Navigator)
16081649 crystal structure of hGSTK1 has been determined by the multiple-isomorphous replacement method and refined to 1.93 A resolution
14742434 Gene and protein characterization; its subcellular localization in peroxisomes, suggesting a new function for this family of enzymes [glutathione S-transferase kappa (hGSTK1)]
14742434 Presence of hGSTK1 in both peroxisomes and mitochondria. The C-terminus of hGSTK1 is essential for localization of the protein to peroxisomes, and the C-terminal sequence Ala-Arg-Leu represents a peroxisome targeting signal 1 (PTS1).
14709161 structure and function characterization of a GST from human breast

AA Sequence 

MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDL      1 - 70
KLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILA     71 - 140
AAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLL    141 - 210
GEKWMGPIPPAVNARL                                                          211 - 226
//

Text Mined References (38)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25739441 2015 Endoplasmic reticulum (ER) localization is critical for DsbA-L protein to suppress ER stress and adiponectin down-regulation in adipocytes.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23426619 2013 Detection of tyrosine?phosphorylated proteins in hepatocellular carcinoma tissues using a combination of GST?Nck1?SH2 pull?down and two?dimensional electrophoresis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23330092 2012 Expression of genes of glutathione transferase isoforms GSTP1-1, GSTA4-4, and GSTK1-1 in tumor cells during the formation of drug resistance to cisplatin.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21269460 2011 Initial characterization of the human central proteome.
20472488 2010 GST polymorphisms, interaction with smoking and pesticide use, and risk for Parkinson's disease in a Japanese population.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
19946888 2010 Defining the membrane proteome of NK cells.
19639233 2009 Group B Streptococcus induces tyrosine phosphorylation of annexin V and glutathione S-transferase in human umbilical vein endothelial cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19225211 2009 Polymorphism of DsbA-L gene associates with insulin secretion and body fat distribution in Chinese population.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18774560 2009 Association of CYP1A1 and glutathione S-transferase polymorphisms with male factor infertility.
18154451 2008 Genetic polymorphisms of human cytosol glutathione S-transferases and prostate cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16381901 2006 The LIFEdb database in 2006.
16081649 2005 Thioredoxin-like domain of human kappa class glutathione transferase reveals sequence homology and structure similarity to the theta class enzyme.
15607001 2004 Analysis of the glutathione S-transferase (GST) gene family.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14742434 2004 Gene and protein characterization of the human glutathione S-transferase kappa and evidence for a peroxisomal localization.
14709161 2004 Modelling and bioinformatics studies of the human Kappa-class glutathione transferase predict a novel third glutathione transferase family with similarity to prokaryotic 2-hydroxychromene-2-carboxylate isomerases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12720545 2003 Biochemical and genetic characterization of a murine class Kappa glutathione S-transferase.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
8920976 1996 Glutathione S-transferase class Kappa: characterization by the cloning of rat mitochondrial GST and identification of a human homologue.