Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.46
PubTator Score 3.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.595 1.3e-04
medulloblastoma, large-cell 1.500 3.3e-04
lung cancer -1.300 1.5e-04
group 3 medulloblastoma 1.200 1.5e-03
ductal carcinoma in situ 1.100 6.7e-04
invasive ductal carcinoma 1.100 5.4e-03
ovarian cancer -1.300 2.9e-05
pituitary cancer 1.500 6.6e-10

Synonym

Accession Q8NEC7 A8K8J0 A8MVD3 H9KV97 Q9H8S3
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

PMID Text
24915237 Air pollution exposure entails an increased risk of acute myocardial infarction, and this risk differed over genotype strata for variants in the GSTP1, GSTT1 and GSTCD genes, albeit not statistically-significantly.
24058608 In fixed sections of human lung tissue, GSTCD protein expression was ubiquitous, whereas INTS12 expression was predominantly in epithelial cells and pneumocytes.
21965014 GSTCD polymorphism associated with COPD risk and lung function decline
20332099 Observational study of gene-disease association. (HuGE Navigator)
20010835 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20010834 Data show expression of TNS1, GSTCD, AGER, HTR4 and THSD4 in lung tissue and indicate potential targets for interventions to alleviate respiratory disease.
20010834 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MKAIKKSLTEEEYLYLDFSHQTEGCIFPLHTSVTLFLLSYCDCKIFKICLVVTKEVSRDSSLLRDDLIQD      1 - 70
VEIQIISRQELPPIVQNCCLPAVVERSDNFCRAGLAVVLRHIIQKSYEADPLKKELLELLGFKKTCLKAC     71 - 140
AEVSQWTRLCELTIPLAIENFLRESSDQPPTIPVEILQLEKKLSEPVRVHNDDKLRRQKLKQQKADGVGP    141 - 210
PLTKGKAKSKVHTQETSEGLDSSSKSLELKVAFSKLTVQEEPATTNREPSHIRKAKASDLPPLEHVFAEG    211 - 280
LYFTLADIVLLPCIHHFLVIISRKFSEKLVEFPLLASWYQRIQEVPGVKTAASKCGIQFLHLPKLLTTST    281 - 350
EQHPNLCEVPGVEEQSDPLFIGGPRPTMAKLMEKGIEVMFSPHPCPTWTLDWNVLPAAVSPKEGKMSSDR    351 - 420
ALRKQQQLNNLVYVVTNQAKPGDRIVDFCSGGGHVGIVLAHMLPSCQVTLIENKELSLIRAKKRSDELGL    421 - 490
SNIWFIQANMEYFTGMFNIGVALHACGVATDMVIEHCIKTRASFVTCPCCYGFIQNTSKFNFPKSEQFKK    491 - 560
TLSYKEHMILCRFADQTAVQLPPQRRLIGKQCMCLVDLDRARAAEECGYSVQVISMEPESCSPKNNMIVG    561 - 630
VPI                                                                       631 - 633
//

Text Mined References (17)

PMID Year Title
24915237 2014 Interaction effects of long-term air pollution exposure and variants in the GSTP1, GSTT1 and GSTCD genes on risk of acute myocardial infarction and hypertension: a case-control study.
24058608 2013 GSTCD and INTS12 regulation and expression in the human lung.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21965014 2011 Effect of five genetic variants associated with lung function on the risk of chronic obstructive lung disease, and their joint effects on lung function.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
20010835 2010 Meta-analyses of genome-wide association studies identify multiple loci associated with pulmonary function.
20010834 2010 Genome-wide association study identifies five loci associated with lung function.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.