Property Summary

NCBI Gene PubMed Count 21
PubMed Score 27.18
PubTator Score 41.79

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q16772 O43468 Q068V6 Q8WWA8 Q9H415
Symbols GTA3
GSTA3-3

Gene

PDB

1TDI   2VCV  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (12)

PMID Text
25248748 analysis of how isomerization of the steroid Delta(5)-androstene-3,17-dione by the glutathione transferase A3-3
24739064 Density functional theory calculations used to propose a refined mechanism for the isomerization of delta(5)-androstene-3,17-dione catalyzed by GST A3-3
23650189 Data indicate that steroidogenic factor 1 (SF-1) and glutathione S-transferase A (GSTA) family genes (hGSTA1-hGSTA4) are involved in steroidogenesis.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20200426 Observational study of gene-disease association. (HuGE Navigator)
20083122 The 3D structures of human GSTs A2-2 and A3-3 in complex with Delta(4)-androstene-3-17-dione, were solved.
19343046 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18426392 Significantly contributes to the double-bond isomerization necessary for steroid hormone biosynthesis in complex systems, thereby complementing the indispensable 3beta-hydroxysteroid oxidoreductase activity of 3beta-hydroxysteroid dehydrogenase.
17601350 Observational study of gene-disease association. (HuGE Navigator)
15595823 Analysis of the active centers of hGSTA3-3 reveals that residues in positions 12 and 208 may contribute to its disparate isomerase activity toward Delta(5)-AD.
15454730 describe an I71L polymorphism in GSTA3 that occurs at a low frequency in African populations

AA Sequence

MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGMKLVQTRA      1 - 70
ILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVL     71 - 140
QSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADA    141 - 210
KALEEARKIFRF                                                              211 - 222
//

Text Mined References (21)

PMID Year Title
25248748 2014 The isomerization of ?5-androstene-3,17-dione by the human glutathione transferase A3-3 proceeds via a conjugated heteroannular diene intermediate.
24739064 2014 Isomerization of ?5-androstene-3,17-dione into ?4-androstene-3,17-dione catalyzed by human glutathione transferase A3-3: a computational study identifies a dual role for glutathione.
23650189 2013 Human glutathione S-transferase A (GSTA) family genes are regulated by steroidogenic factor 1 (SF-1) and are involved in steroidogenesis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20200426 2010 Glutathione pathway genetic polymorphisms and lung cancer survival after platinum-based chemotherapy.
20083122 2010 Structural basis for featuring of steroid isomerase activity in alpha class glutathione transferases.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18426392 2008 Targeting human glutathione transferase A3-3 attenuates progesterone production in human steroidogenic cells.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
16876319 2006 Mutation analyses of genes on 6p12-p11 in patients with juvenile myoclonic epilepsy.
15595823 2004 Crystal structure of human glutathione S-transferase A3-3 and mechanistic implications for its high steroid isomerase activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15454730 2004 Functional polymorphism of human glutathione transferase A3: effects on xenobiotic metabolism and steroid biosynthesis.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11872752 2002 Active-site residues governing high steroid isomerase activity in human glutathione transferase A3-3.
11418619 2001 Human glutathione transferase A3-3, a highly efficient catalyst of double-bond isomerization in the biosynthetic pathway of steroid hormones.
9480897 1998 Identification of cDNAs encoding two human alpha class glutathione transferases (GSTA3 and GSTA4) and the heterologous expression of GSTA4-4.
8307579 1993 Structure and organization of the human alpha class glutathione S-transferase genes and related pseudogenes.