Property Summary

NCBI Gene PubMed Count 57
PubMed Score 68.24
PubTator Score 77.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 733 0.0 0.0
Disease Target Count P-value
psoriasis 6514 1.9e-03
lung carcinoma 2755 1.8e-02
non-inflammatory breast cancer 63 3.0e-02
Disease Target Count Z-score Confidence
Spiradenoma 7 3.034 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
lung carcinoma -1.200 1.8e-02
non-inflammatory breast cancer -1.200 3.0e-02
psoriasis -1.700 1.9e-03

Protein-protein Interaction (4)

Gene RIF (33)

AA Sequence

MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRA      1 - 70
ILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFSQPEEQDAKLALIQEKTKNRYFPAFEKVL     71 - 140
KSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDE    141 - 210
KSLEESRKIFRF                                                              211 - 222
//

Text Mined References (58)

PMID Year Title