Property Summary

NCBI Gene PubMed Count 68
PubMed Score 830.61
PubTator Score 2185.12

Knowledge Summary

Patent

No data available

Expression

Gene RIF (37)

PMID Text
26419038 The recurrence of benign tumors of mammary gland occurred predominantly in women-carriers of mutant alleles with polymorphism rs8190924 of gene GSR and AA rs3763511of gene DKK4.
26316444 Plasma glutathione reductase (GR) activity was correlated with erythrocyte GR activity and the erythrocyte reduced glutathione/glutathione disulfide ratio. A decrease in plasma GR activity was associated with an increase in mortality in septic shock.
25645953 Glutathione reductase reduces mitochondrial protein mitoNEET [2Fe-2S] clusters.
23770363 1,25 (OH) vitamin D significantly upregulated expression of GCLC and GR and lowered secretion of IL-8 and MCP-1 in high-glucose exposed U937 monocytes.
23637325 GSR was the most significant single SNP association with systemic lupus erythematosus in African Americans.
22944692 Positional proteomics analysis identifies the cleavage of human glutathione reductase, mitochondria (GSR) at amino acid residues 67-68 by the HIV-1 protease
22089180 The results demonstrate for the first time that glutathione reductase gene polymorphisms are significantly associated with bone mineral density.
21417634 Up-regulation of CAT and GR activity resulted in an increase in total antioxidant activity in A549 after exposure to B(a)P.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628807 novel glutathione reductase alternative splice variants
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20586645 Human eye lenses were dissected into discrete regions that were formed at different stages of life and assayed for activity of lactate dehydrogenase (LDH) and a particularly stable enzyme, glutathione reductase (GR).
20485444 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20200426 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19896490 Observational study of gene-disease association. (HuGE Navigator)
19806191 GR deficiency and drug-induced GR inhibition may protect from malaria by inducing enhanced ring stage phagocytosis rather than by impairing parasite growth directly [case study]
19560448 An increase in the activities of superoxide dismutase was observed in patients with active and silent celiac disease, while the activities of glutathione peroxidase and glutathione reductase and the glutathione content were significantly reduced.
19527700 Data show that decreased activities of GPX1, increased activities of GR and CuZnSOD in women with depressive disorder.
19377255 higher glutathione reductase and total antioxidant capacity were found in end-stage renal disease patients than in controls
19124506 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
18638483 Data report synchrotron-based cryocrystallographic studies of natural substrate complexes of the flavoenzyme human glutathione reductase at nominal resolutions between 1.1 and 0.95 A that reveal new aspects of its mechanism.
18341267 Inhibitory effects of several antibiotics on purified human erythrocyte glutathione reductase has been investigated.
17601350 Observational study of gene-disease association. (HuGE Navigator)
17206382 Data show that both glutathione and glutathione reductase are inducible by D3T, and that upregulation of GSH biosynthesis underlies D3T-mediated cytoprotection against ROS/RNS-elicited injury to human vascular smooth muscle cells.
16868544 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16424062 Observational study of gene-disease association. (HuGE Navigator)
15978628 Decreased activities of erythrocyte glutathione reductase is associated with cerebral palsy
15149466 No statistically significant differences for glutathione peroxidase, phospholipid hydroperoxide glutathione peroxidase, and glutathione reductase were encountered between normal values and those of asthenozoospermic patients.
14637279 serum concentrations in patients with chronic lymphocytic leukemia
12838770 GR activity in COPD and chest osteomyelitis decreased by 40% and more, lung tumors--by 32-36%.
12838767 Patients with chronic alcoholism (PCA) of stage II have increased glutathione reductase (GR) activity in neutrophils, lymphocytes and monocytes compared with that in the cells of healthy donors
12826156 An oxidative stress marker after kidney transplantation
12516882 activities of catalase (CAT), glutathione reductase (GR), glutathione peroxidase (GPx) and superoxide dismutase (SOD) were decreased during intense physical exercise
12447480 Malignant lung tumors (squamous cell carcinoma and adenocarcinoma) had increased activity of this enzyme.

AA Sequence

MALLPRALSAGAGPSWRRAARAFRGFLLLLPEPAALTRALSRAMACRQEPQPQGPPPAAGAVASYDYLVI      1 - 70
GGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMHDHADYGFPSCEGKFNW     71 - 140
RVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMPSTPHES    141 - 210
QIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTE    211 - 280
ELENAGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQ    281 - 350
TDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPP    351 - 420
IGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQG    421 - 490
FAVAVKMGATKADFDNTVAIHPTSSEELVTLR                                          491 - 522
//

Text Mined References (72)

PMID Year Title
26419038 2015 [MODERN METHODS OF PROGNOSTICATION OF THE RECURRENCES OCCURRENCE AFTER SURGICAL TREATMENT OF THE MAMMARY GLAND BENIGN TUMORS].
26316444 2016 Plasma glutathione reductase activity and prognosis of septic shock.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25645953 2015 Reduction of mitochondrial protein mitoNEET [2Fe-2S] clusters by human glutathione reductase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23770363 2013 Vitamin D upregulates glutamate cysteine ligase and glutathione reductase, and GSH formation, and decreases ROS and MCP-1 and IL-8 secretion in high-glucose exposed U937 monocytes.
23637325 2013 Variable association of reactive intermediate genes with systemic lupus erythematosus in populations with different African ancestry.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22089180 2012 Antioxidant enzymes GSR, SOD1, SOD2, and CAT gene variants and bone mineral density values in postmenopausal women: a genetic association analysis.
21417634 2011 Comparative proteomic analysis of cellular response of human airway epithelial cells (A549) to benzo(a)pyrene.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628807 2010 Expression of glutathione reductase splice variants in human tissues.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20586645 2010 Age-dependent denaturation of enzymes in the human lens: a paradigm for organismic aging?
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20200426 2010 Glutathione pathway genetic polymorphisms and lung cancer survival after platinum-based chemotherapy.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19896490 2010 Low 8-oxo-7,8-dihydro-2'-deoxyguanosine levels and influence of genetic background in an Andean population exposed to high levels of arsenic.
19806191 2009 Inherited glutathione reductase deficiency and Plasmodium falciparum malaria--a case study.
19560448 2009 Antioxidant status and lipid peroxidation in small intestinal mucosa of children with celiac disease.
19527700 2009 Antioxidative enzymes and increased oxidative stress in depressive women.
19377255 2009 Glutathione, glutathione-related enzymes, and total antioxidant capacity in patients on maintenance dialysis.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18638483 2008 Catalytic cycle of human glutathione reductase near 1 A resolution.
18341267 2008 Effects of some antibiotics on human erythrocyte glutathione reductase: an in vitro study.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17206382 2007 Glutathione and glutathione-linked enzymes in normal human aortic smooth muscle cells: chemical inducibility and protection against reactive oxygen and nitrogen species-induced injury.
17185460 2007 Molecular basis of glutathione reductase deficiency in human blood cells.
16868544 2006 Interactions between genes involved in the antioxidant defence system and breast cancer risk.
16424062 2006 Tagging single-nucleotide polymorphisms in antioxidant defense enzymes and susceptibility to breast cancer.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16341674 2005 Transcriptome analysis of human gastric cancer.
15978628 2005 Antioxidant enzymes and lipid peroxides in children with cerebral palsy.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15149466 2004 Native specific activity of glutathione peroxidase (GPx-1), phospholipid hydroperoxide glutathione peroxidase (PHGPx) and glutathione reductase (GR) does not differ between normo- and hypomotile human sperm samples.
14637279 2003 Glutathione peroxidase, glutathione reductase, Cu-Zn superoxide dismutase activities, glutathione, nitric oxide, and malondialdehyde concentrations in serum of patients with chronic lymphocytic leukemia.
12901426 2003 Neutrophil superoxide anion production, and CAT and GSSGR activity in patients with tuberculosis.
12838770 [The study of the antioxidant enzymes in erythrocytes in lung diseases].
12838767 [Changes in the activity of antioxidant enzymes in different types of leukocytes in patients with chronic alcoholism].
12826156 2003 Study of the activity of glutathione-peroxidase, glutathione-transferase, and glutathione-reductase in renal transplants.
12630007 Antioxidant potential in esophageal, stomach and colorectal cancers.
12533953 2002 The decrease in antioxidant potential in human brain tumours.
12516882 2002 Acute phase immune response to exercise coexists with decreased neutrophil antioxidant enzyme defences.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12447480 2002 Activity of glutathione-metabolizing and antioxidant enzymes in malignant and benign tumors of human lungs.
12095224 2002 Involvement of glutathione and glutathione-related enzymes in the protection of normal and trisomic human fibroblasts against daunorubicin.
11710935 2001 Aging- and photoaging-dependent changes of enzymic and nonenzymic antioxidants in the epidermis and dermis of human skin in vivo.
11273669 2001 The presence of a human UV filter within the lens represents an oxidative stress.
11204445 2000 Ontogenic profile of some antioxidants and lipid peroxidation in human placental and fetal tissues.
10708558 2000 Structural organization of the human glutathione reductase gene: determination of correct cDNA sequence and identification of a mitochondrial leader sequence.
9546215 1998 Enzyme inactivation through sulfhydryl oxidation by physiologic NO-carriers.
9174360 1997 Glutathione reductase turned into trypanothione reductase: structural analysis of an engineered change in substrate specificity.
9151953 1997 Denaturation and reactivation of dimeric human glutathione reductase--an assay for folding inhibitors.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8626496 1996 Kinetics and crystallographic analysis of human glutathione reductase in complex with a xanthene inhibitor.
7663973 1995 Distribution of glutathione and glutathione-related enzyme systems in mitochondria and cytosol of cultured cerebellar astrocytes and granule cells.
7334521 1981 Three-dimensional structure of glutathione reductase at 2 A resolution.
7060551 1982 Glutathione reductase from human erythrocytes. The sequences of the NADPH domain and of the interface domain.
6822532 1983 The catalytic mechanism of glutathione reductase as derived from x-ray diffraction analyses of reaction intermediates.
3656429 1987 Refined structure of glutathione reductase at 1.54 A resolution.
2379581 1990 Treatment of human peripheral lymphocytes with concanavalin A activates expression of glutathione reductase.
2185014 1990 Cloning and sequencing of mammalian glutathione reductase cDNA.
947404 1976 Familial deficiency of glutathione reductase in human blood cells.
923580 1977 Glutathione reductase from human erythrocytes. Isolation of the enzyme and sequence analysis of the redox-active peptide.
302667 1977 [Possible localization of the glutathione reductase (EC 1.6.4.2) on the 8p21 band].