Property Summary

Ligand Count 8
NCBI Gene PubMed Count 69
PubMed Score 863.75
PubTator Score 2185.12

Knowledge Summary


No data available


  Disease (6)


PDB (27)

Gene RIF (38)

AA Sequence

FAVAVKMGATKADFDNTVAIHPTSSEELVTLR                                          491 - 522

Text Mined References (73)

PMID Year Title