Property Summary

NCBI Gene PubMed Count 20
PubMed Score 6.76
PubTator Score 10.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -1.200 1.1e-05
psoriasis -1.400 1.8e-12
medulloblastoma, large-cell -1.400 5.9e-05
intraductal papillary-mucinous carcinoma... -2.300 2.9e-02
breast carcinoma -1.100 1.1e-27
Breast cancer -2.500 6.8e-08
ovarian cancer -2.000 2.7e-04

Gene RIF (5)

PMID Text
24569073 The proteolytic cleavage of eRF3a and eRF3b into p-eRF3 leads to release an amino-terminal fragment containing nuclear export signal to allow the relocalization of eRF3 into the nucleus to interact with the p14ARF.
24466059 The tumor marker eRF3B can change the cell cycle and influence the phosphorylation status of 4E-BP1.
23377885 The survivin and eRF3 complex may function in spindle formation and segregation of chromosomes and cytokinesis.
19417105 eRF1's M domain contacts eRF3's GTPase domain
15987998 eRF3b can substitute for eRF3a in its translation termination function.

AA Sequence

MDSGSSSSDSAPDCWDQVDMESPGSAPSGDGVSSAVAEAQREPLSSAFSRKLNVNAKPFVPNVHAAEFVP      1 - 70
SFLRGPTQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVTMELSEPVVENG     71 - 140
EVEMALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVIVPSGAPKKEHVNVVFIG    141 - 210
HVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETER    211 - 280
KHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINK    281 - 350
MDDPTVNWSIERYEECKEKLVPFLKKVGFSPKKDIHFMPCSGLTGANIKEQSDFCPWYTGLPFIPYLDNL    351 - 420
PNFNRSIDGPIRLPIVDKYKDMGTVVLGKLESGSIFKGQQLVMMPNKHNVEVLGILSDDTETDFVAPGEN    421 - 490
LKIRLKGIEEEEILPGFILCDPSNLCHSGRTFDVQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALISL    491 - 560
VDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD      561 - 628
//

Text Mined References (27)

PMID Year Title
24569073 2014 The processed isoform of the translation termination factor eRF3 localizes to the nucleus to interact with the ARF tumor suppressor.
24466059 2014 eRF3b, a biomarker for hepatocellular carcinoma, influences cell cycle and phosphoralation status of 4E-BP1.
23377885 2013 Polypeptide chain release factor eRF3 is a novel molecular partner of survivin.
23340509 2013 Phosphorylation at intrinsically disordered regions of PAM2 motif-containing proteins modulates their interactions with PABPC1 and influences mRNA fate.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
19417105 2009 Structural insights into eRF3 and stop codon recognition by eRF1.
19417104 2009 SMG-8 and SMG-9, two novel subunits of the SMG-1 complex, regulate remodeling of the mRNA surveillance complex during nonsense-mediated mRNA decay.
18447585 2008 A competition between stimulators and antagonists of Upf complex recruitment governs human nonsense-mediated mRNA decay.
18264098 2008 Common sequence variants on 2p15 and Xp11.22 confer susceptibility to prostate cancer.
17562865 2007 Human eukaryotic release factor 3a depletion causes cell cycle arrest at G1 phase through inhibition of the mTOR pathway.
16754297 2006 Evolution of translation termination factor eRF3: is GSPT2 generated by retrotransposition of GSPT1's mRNA?
16721809 2006 Transcriptional census of 36 microdissected colorectal cancers yields a gene signature to distinguish UICC II and III.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15987998 2005 Involvement of human release factors eRF3a and eRF3b in translation termination and regulation of the termination complex formation.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14685257 2004 Structural basis of ligand recognition by PABC, a highly specific peptide-binding domain found in poly(A)-binding protein and a HECT ubiquitin ligase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12354098 2002 Mouse GSPT2, but not GSPT1, can substitute for yeast eRF3 in vivo.
11524954 [Identification of a novel termination release factor eRF3b expressing the eRF3 activity in vitro and in vivo].
10575220 1999 Assignment of the human peptide chain release factor 3 (GSPT2) to Xp11.23-->p11.21 and of the distal marker DXS1039 by radiation hybrid mapping.
10358005 1999 The eukaryotic polypeptide chain releasing factor (eRF3/GSPT) carrying the translation termination signal to the 3'-Poly(A) tail of mRNA. Direct association of erf3/GSPT with polyadenylate-binding protein.
9712840 1998 Molecular cloning of a novel member of the eukaryotic polypeptide chain-releasing factors (eRF). Its identification as eRF3 interacting with eRF1.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.