Property Summary

NCBI Gene PubMed Count 21
PubMed Score 7.36
PubTator Score 10.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer -2.500 6.8e-08
breast carcinoma -1.100 1.1e-27
intraductal papillary-mucinous carcinoma... -2.300 2.9e-02
malignant mesothelioma -1.200 1.1e-05
medulloblastoma, large-cell -1.400 5.9e-05
ovarian cancer -2.000 2.7e-04
psoriasis -1.400 1.8e-12

Gene RIF (6)

AA Sequence

MDSGSSSSDSAPDCWDQVDMESPGSAPSGDGVSSAVAEAQREPLSSAFSRKLNVNAKPFVPNVHAAEFVP      1 - 70
SFLRGPTQPPTLPAGSGSNDETCTGAGYPQGKRMGRGAPVEPSREEPLVSLEGSNSAVTMELSEPVVENG     71 - 140
EVEMALEESWEHSKEVSEAEPGGGSSGDSGPPEESGQEMMEEKEEIRKSKSVIVPSGAPKKEHVNVVFIG    141 - 210
HVDAGKSTIGGQIMFLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETER    211 - 280
KHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINK    281 - 350
MDDPTVNWSIERYEECKEKLVPFLKKVGFSPKKDIHFMPCSGLTGANIKEQSDFCPWYTGLPFIPYLDNL    351 - 420
PNFNRSIDGPIRLPIVDKYKDMGTVVLGKLESGSIFKGQQLVMMPNKHNVEVLGILSDDTETDFVAPGEN    421 - 490
LKIRLKGIEEEEILPGFILCDPSNLCHSGRTFDVQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALISL    491 - 560
VDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD      561 - 628
//

Text Mined References (28)

PMID Year Title