Property Summary

Ligand Count 523
NCBI Gene PubMed Count 969
PubMed Score 610.78
PubTator Score 1876.17

Knowledge Summary

Patent (67,254)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
diabetes mellitus 1728 3.442 1.7

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.400 7.8e-06
astrocytoma 1.400 4.9e-03
atypical teratoid / rhabdoid tumor -1.300 1.6e-05
Breast cancer 2.200 4.8e-02
ependymoma -1.400 2.6e-02
glioblastoma -1.200 6.8e-09
group 4 medulloblastoma 1.700 2.5e-03
intraductal papillary-mucinous adenoma (... 1.200 1.1e-03
intraductal papillary-mucinous carcinoma... 1.300 1.0e-03
intraductal papillary-mucinous neoplasm ... 1.300 1.1e-02
medulloblastoma, large-cell -1.200 1.0e-04
oligodendroglioma 1.300 1.7e-03
osteosarcoma -1.150 1.2e-03
ovarian cancer -1.200 8.9e-05
Pick disease 1.700 7.3e-05
psoriasis -1.400 3.8e-04
spina bifida -1.051 4.8e-02
subependymal giant cell astrocytoma -1.187 3.8e-02
tuberculosis 1.200 2.1e-05

Synonym

Accession P49841 D3DN89 Q9BWH3 Q9UL47 GSK-3 beta
Symbols

Gene

Protein-protein Interaction (1)

PDB (72)

Gene RIF (827)

AA Sequence

MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVV      1 - 70
YQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVY     71 - 140
RVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRG    141 - 210
EPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ    211 - 280
IREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKL    281 - 350
PNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST    351 - 420
//

Text Mined References (994)

PMID Year Title