Property Summary

NCBI Gene PubMed Count 865
PubMed Score 567.70
PubTator Score 1876.17

Knowledge Summary

Patent (67,254)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Alzheimer's disease 644 5.125 2.6
diabetes mellitus 1663 3.271 1.6

Expression

  Differential Expression (19)

Disease log2 FC p
ependymoma -1.400 2.6e-02
oligodendroglioma 1.300 1.7e-03
psoriasis -1.400 3.8e-04
osteosarcoma -1.150 1.2e-03
glioblastoma -1.500 3.9e-07
astrocytoma 1.400 4.9e-03
atypical teratoid / rhabdoid tumor -1.300 1.6e-05
group 4 medulloblastoma 1.700 2.5e-03
medulloblastoma, large-cell 1.700 1.4e-05
tuberculosis 1.200 2.1e-05
intraductal papillary-mucinous adenoma (... 1.200 1.1e-03
intraductal papillary-mucinous carcinoma... 1.300 1.0e-03
intraductal papillary-mucinous neoplasm ... 1.300 1.1e-02
Breast cancer 2.200 4.8e-02
adult high grade glioma -1.400 7.8e-06
subependymal giant cell astrocytoma -1.187 3.8e-02
spina bifida -1.051 4.8e-02
Pick disease 1.700 7.3e-05
ovarian cancer 2.000 7.6e-08

Synonym

Accession P49841 D3DN89 Q9BWH3 Q9UL47 GSK-3 beta
Symbols

Gene

PDB

1O9U   3ZDI   4B7T   4NM0   4NM3   4NM5   4NM7   1GNG   1H8F   1I09   1J1B   1J1C   1O6K   1O6L   1PYX   1Q3D   1Q3W   1Q41   1Q4L   1Q5K   1R0E   1UV5   2JDO   2JDR   2JLD   2O5K   2OW3   2UW9   2X39   2XH5   3CQU   3CQW   3DU8   3E87   3E88   3E8D   3F7Z   3F88   3GB2   3I4B   3L1S   3M1S   3MV5   3OW4   3PUP   3Q3B   3QKK   3SAY   3SD0   3ZRK   3ZRL   3ZRM   4ACC   4ACD   4ACG   4ACH   4AFJ   4DIT   4EKK   4IQ6   4J1R   4J71   4PTC   4PTE   4PTG   5F94   5F95   5HLN   5HLP   5K5N  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

  TechDev Info (1)

Gary Johnson 302 Kinome profile via MIB/MS Technology

 GWAS Trait (1)

Protein-protein Interaction (3)

MLP Assay (14)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
2097 screening 116 / 0 / 302387 Cell-Free Homogeneous Primary HTS to Identify Inhibitors of GSK3beta Activity
2119 summary 0 / 0 / 0 Summary of Probe Development Efforts to Identify Inhibitors of Glycogen Synthase Kinase-3 beta (GSK-3b)
434954 confirmatory 581 / 12 / 1605 Luminescence Cell-Free Homogeneous Dose Retest to Identify Inhibitors of Glycogen Synthase Kinase-3 beta Activity
588406 confirmatory 16 / 0 / 0 Inhibition of Human GSK-3 beta Activity Measured in Biochemical System Using Microfluidics - 2063-05_Inhibitor_Dose_DryPowder_Activity
588429 confirmatory 25 / 1 / 0 Inhibition of Human GSK-3 beta Activity Measured in Biochemical System Using Microfluidics - 2063-05_Inhibitor_Dose_DryPowder_Activity_Set2
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
602272 confirmatory 1 / 0 / 36 Inhibition of Human GSK3 beta Activity Measured in Biochemical System Using Plate Reader - 2083-02_Inhibitor_Dose_DryPowder_Activity
623989 confirmatory 21 / 2 / 1 Inhibition of Human GSK3 beta Activity Measured in Biochemical System Using Microfluidics - 2046-10_Inhibitor_Dose_DryPowder_Activity_Set2
623998 confirmatory 81 / 6 / 3 GSK3beta Measured in Biochemical System Using Plate Reader - 2046-01_Inhibitor_Dose_DryPowder_Activity
More...

Gene RIF (729)

PMID Text
26850078 MPT induced by MF exposure was mediated through the ROS/GSK-3beta signaling pathway.
26845447 TSSC3 downregulation promotes the Epithelial to mesenchymal transition (EMT) of osteosarcoma cells by regulating EMT markers via a signal transduction pathway that involves Snail, Wnt-beta-catenin/TCF, and GSK-3beta
26826001 overexpression of the IGF-1R, and activation of GSK3beta and FOXO3a might be the molecular mechanisms underlying the development of liver cirrhosis
26822034 The induction of GSK3B phosphorylation by DNA double-strand breaks through ATM as a unique mechanism to attenuate the activity of nuclear GSK3beta and promote survival of cells is reported.
26766591 reveals that GSK-3alpha- and GSK-3beta-regulated pathways can be responsible for stepwise transition to myelodysplastic syndromes and subsequent acute myeloid leukemia
26711256 The PKC-zeta - induced phosphorylation of GSK-3 beta stimulates GSK-3 beta activity.
26707164 binding between AMPK and b-catenin occurs in the cytosolic fraction, and therefore concluded that the cancer cell antiproliferative effects of selenium are mediated by a GSK3b-independent AMPK/b-catenin pathway
26707073 CD151 knockdown inhibits the expression of MMP9 through the GSK-3b/bcatenin pathway and also inhibits Osteosarcoma (OS)migration and invasion in vitro and metastasis in vivo in highly metastatic OS.
26631736 There was 25% lower inhibitory phosphorylation of GSK-3beta in umbilical cord MSCs from obese mothers compared to cord MSCs from normal weight mothers.
26618897 Study provides evidence that GSK3beta activity can be compromised in cartilage of obese osteoarthritis patients and show its requirement for chondrocyte mitochondrial function and prevention of oxidative damage, hypertrophy and senescence.
26560046 These data indicated that GSK3beta may participated in HPV16 mediated deregulation of wnt/beta-catenin and other signaling pathways promoting the progression and invasion of cervical cancers.
26546129 disrupted in schizophrenia 1 regulates pancreatic beta-cell function via glycogen synthase kinase-3beta.
26530498 The TIPE2-elicited antimetastatic effect in gastric cancer was closely associated with the inhibition of AKT signaling and enhancement of GSK3b activity followed by the degradation and decreased translocation to nucleus of b-catenin
26499802 PI3K-Akt-GSK3beta signaling pathway is required for SIRT1 induction by ER stress.
26496802 Inhibition of DYRK1A and GSK3B induces human beta-cell proliferation.
26440826 GSK-3Beta plays an important role in controlling autophagy induction by modulating LKB1-AMPK pathway in prostate cancer cells.
26431581 Critical link between glycogen synthase kinase 3beta and forkhead box P3 in patients with chronic rhinosinusitis with nasal polyps
26398368 our findings indicate that TSN inhibits growth and induces apoptosis in CRC cells through suppression of AKT/GSK-3b/b-catenin pathway, suggesting that TSN may have potential for use in CRC treatment
26388612 GSK-3beta regulates mTOR/p70S6K1 signaling pathway and inhibits glioma progression in vivo.
26372541 Results demonstrate that betaArr2 signaling may be an important pathway for TAAR1 function and that the activation of the TAAR1-D2R complex negatively modulates GSK3b signaling
26359353 Data indicate that N-myc downstream regulated gene 1 (NDRG1) competitively bind to glycogen synthase kinase 3beta (GSK-3beta) and orphan nuclear receptor (Nur77) to prevent beta-catenin degradation.
26320152 Reactive oxygen species (ROS)-induced glucocorticoid unresponsiveness in COPD is mediated through GSK3B, acting as a ROS-sensitive hub.
26311646 Findings suggest that brain-derived neurotrophic factor promotes the growth of neurons in vitro through crosstalk with the Wnt/beta-catenin signaling pathway, and that this interaction may be mediated by glycogen synthase kinase 3 beta.
26311045 Human placental extract exerts hair growth-promoting effects through the GSK-3beta signaling pathway in human dermal papilla cells.
26284974 Finally, pro-incubation with idebenone inhibited mitochondrial dysfunction induced by oxLDL through the mitochondrial-dependent apoptotic pathway and GSK3beta/beta-catenin signalling pathways.
26281299 Changes in GSK3beta activity and its polymorphisms may have an impact on smoking habits.
26274564 FAK and PYK2 functioned redundantly to promote the Wnt/beta-catenin pathway by phosphorylating GSK3beta(Y216) to reinforce pathway output-beta-catenin accumulation and intestinal tumorigenesis.
26240334 FXR1P is a GSK3beta substrate with a role in regulating mood and emotion processing
26240274 GSK3beta expression is a strong prognosticator in PDAC, independent of other known factors such as tumor (T) stage, nodal status, surgical margins and CA19-9.
26236947 Data suggest that activation of AMPK (AMP-activated protein kinase) in triple negative breast cancer cells down-regulates expression of MTDH (metadherin) via up-regulation of GSK3B (glycogen synthase kinase 3 beta) and SIRT1 (sirtuin 1) activities.
26209183 Data indicate that the binding of inhibitors with Lys85, Thr138, and Arg141 in the binding site of glycogen synthase kinase 3 beta (GSK-3beta) show selectivity.
26194614 results provide additional evidence of a genetic interaction between GSK3beta and APBB2 and further suggest that GSK3beta is involved in the pathophysiology of both of the primary neuropathologies of Alzheimer's disease
26186530 Results provide evidence that the GSK3B gene could be a promising region which contains genetic risk for both major depressive disorder and schizophrenia in the Han Chinese population
26139537 CRISPR-Cas9n-mediated knockout and reconstitution studies establish that dynamin-1 is activated by Akt/GSK3beta signaling in H1299 non-small lung cancer cells.
26129946 inhibition of GSK-3beta reduces myocardin transcriptional activity, suggesting a role for GSK-3beta in myocardin transcriptional activity and smooth muscle differentiation
26121043 the anti-proliferative effect of resibufogenin may be attributed to the degradation of cyclin D1 caused by the activation of GSK-3beta
26119563 Data show that activation of EphB2 receptor kinase arrests tau protein hyperphosphorylation through phosphatidylinositol 3-kinase (PI3K)/Akt protein-mediated glycogen synthase kinase-3beta (GSK-3beta) inhibition.
26097594 Results show that the expression of GSK3beta may be associated with differentiation of ectodermal derived tissues and pS9GSK3beta with that of epithelial cells of endodermal derived tissues in human.
26095393 Quantitative RT-PCR analysis showed that SOST expression dose-dependently decreased with increasing Wnt signaling, while BMP4 induced SOST expression
26088648 MiR-26b regulates beta-catenin levels by inhibiting GSK-3beta expression, which in-turn alters the Wnt/GSK-3beta/beta-catenin pathway to lower rheumatoid arthritis fibroblast-like synoviocyte proliferation and elevate cell apoptosis.
26088133 Protein Kinase A Opposes the Phosphorylation-dependent Recruitment of Glycogen Synthase Kinase 3beta to A-kinase Anchoring Protein 220.
26063791 We defined a novel molecular signature in mammalian HNSCC, suggesting new treatment strategies targeting the GRHL3/GSK3B/c-MYC proto-oncogenic network.
26022178 GSK-3 undergoes inhibitory phosphorylation at regulatory serine residues by the engagement of NKG2D and 2B4, either individually or in combination.
25963821 tau allows Abeta oligomers to inhibit axonal transport through activation of GSK3beta, possibly by facilitating aberrant neuronal activity.
25941117 Thus, our results support the relevance of GSK-3beta and autophagy as two targets for controlling cell cycle progression and proliferative capacity in MCF7
25935310 CHP3 functions as a novel negative regulator of cardiomyocyte hypertrophy via inhibition of GSK3alpha/beta phosphorylation.
25897075 analysis of how Rictor undergoes GSK3-dependent, FBXW7-mediated ubiquitination and proteasomal degradation
25881103 Inhibition of NMMHC IIA impedes TF expression and venous thrombosis via Akt/GSK3beta-NF-kappaB signalling pathways in the endothelium both in vitro and in vivo.
25868609 induces AKT and GSK3beta phosphorylation as well as proliferation in HTR-8/SVneo cells, model of human extravillous trophoblast
25865493 Seven different de novo missense mutations involving conserved residues of the four GSK3 phosphorylation motifs were identified in eight unrelated individuals
25858425 CLEC-2 regulates Akt and MAPK downstream of PI3K and PKC, leading to phosphorylation and inhibition of GSK3alpha/beta, and enhanced platelet aggregation and secretion.
25846563 active forms of STAT3 (pSTAT3) and GSK-3beta (pGSK-3beta) were found in 68 (25%) and 124 (46%) of 267 gastric cancer cases, respectively, showing a positive correlation (p < 0.001)
25829335 we highlight the interaction between GSK-3beta and several cellular processes involved in the pathogenesis of Parkinson's disease--{REVIEW}
25797247 Enforced activation of GSK3beta sensitized cells to rapamycin. GSK3 plays a role in regulating degradation of some oncogenic proteins induced by rapalogs and cell sensitivity to rapalogs.
25771860 Data indicate that dysfunction of the Rho-associated kinase 2 (Rock2)-p-GSK3beta/beta-catenin-CCAAT/enhancer-binding protein delta (CEBPD) regulatory circuitry may contribute to the tumorigenic characteristic of hepatocellular carcinoma (HCC).
25754137 The docking and molecular dynamics investigation performed here led to the identification of the interactions responsible for stabilizing the ligand ChEMBL474807 at the active sites of the glycogen synthase kinase-3beta (GSK-3) and cyclin-dependent kinase-2
25752456 Glycogen synthase kinase 3beta inhibition promotes human iTreg differentiation and suppressive function
25728276 Results revealed S422 as a novel phosphorylation site of Osx and GSK-3b played an important role in regulating the protein stability and transactivational activity of Osx.
25673709 STAT-5 regulates Tip60 activation and this occurs in part by targeting glycogen synthase kinase 3beta during papillomavirus infection.
25645517 The increased expression of GSK3beta correlated positively with cyclin D1 and p53 expression.
25632187 beta-escin was a potent reverser of P-gp-dependent multidrug resistance in cholangiocarcinoma cells, likely via inhibition of the GSK3beta/beta-catenin pathway.
25593505 demonstrate a novel, but likely disadvantageous, link between beta-catenin's influence on the expression of the pro-survival protein, VEGF, resulting in enhanced lens epithelial cell mitochondrial protection against depolarization
25591548 IL-18 activated GSK3beta played an important role in the inhibition of tongue squamous cell carcinoma cell growth
25575054 GSK3beta is an important signaling molecule in the apoptosis pathway induced by oxidative stress.
25561726 Data indicate that autophagy inhibition promotes glycogen synthase kinase-(GSK3) inhibition-induced apoptosis.
25550525 Glycogen synthase kinase 3 alpha and beta activity is increased in foetal membranes after term and preterm labour
25541965 GSK3 activity is increased in gestational diabetes adipose tissue and skeletal muscle
25532422 The process of generation of HPV-16-associated cervical tumorigenesis is synergized with GSK3beta inactivation and overactivation of Wnt/beta-catenin pathway.
25528666 Study identifies GSK3beta as a serine/threonine kinase participating in intracellular signaling of Sema3A that induces acceleration of axonal transport
25504636 Inhibition of GSK3beta attenuated the migration and invasion of glioblastoma cells associated with suppression focal adhesion kinase, guanine nucleotide exchange factors/Rac1 and c-Jun N-terminal kinase.
25486988 Lower glycogen synthase kinase (GSK)-3beta is a expression generated by amyloid-beta immunotherapy shows evidence of a modification of the signalling pathway induced by GSK-3beta leading to the overall reduction of tau.
25484286 Results that GSK3beta could regulate BDNF-dependent TrkB endocytosis through phosphorylating Ser-774 residue on Dyn1 and therefore influence BDNF-induced downstream signaling
25420549 The results of this study found GSK3B gene variants associated with cognitive function and CSF biomarkers T-tau and Abeta42
25398937 Platelet PI3Kbeta and GSK3 regulate thrombus stability at a high shear rate.
25394490 alpha-Syn and Tau together cooperated with one another to increase the magnitude or rate of phosphorylation of the other by GSK-3beta.
25390651 Accelerated recovery of mitochondrial membrane potential by GSK-3beta inactivation affords cardiomyocytes protection from oxidant-induced necrosis.
25380769 investigated functional links between MKL1 and proteins encoded by other schizophrenia susceptibility genes; found MKL1 physically interacts with GSK3B, a protein encoded by a well-characterized schizophrenia susceptibility gene
25351705 findings suggest that there exists a significant association between GSK3beta rs334558 T>C polymorphism and increased susceptibility of Alzheimers Disease
25345732 Promoter gene variants in GSK-3Beta, along with lithium, influence cortical gray matter volumes in bipolar disorder.
25344882 Results suggest that GSK3b may function as a regulator of apoptosis and tumorigenesis in glioblastoma stem-like cell through EGFR and PP2A signalling
25344861 GSK-3beta activity is linked to cytoskeletal protein F-actin and inhibition of GSK-3beta leads to disturbance of F-actin polymerization. This may underlie the dramatic effects of GSK-3beta inhibition on prostate cancer migration.
25331948 Syk regulates amyloid-beta production via NF-kappaB-dependent mechanisms and Tau phosphorylation by controlling the activation of GSK3beta.
25327559 Report role of GSK-3/AR/NFkappaB signaling in prostate cancer.
25301365 Membrane AR activation regulates late expression and/or activity of the tumorigenic gene products c-Src, GSK-3beta. and beta-catenin
25265336 The expression of miR-135b or GSK3beta was significantly association with ionizing radiation resistance of glioblastoma multiforme samples.
25231989 GSK3B-dependent phosphorylation and the level of CLASP2 play a role in the maintenance of acetylcholine receptor cluster size through the regulated capture and release of microtubule plus-ends.
25219467 GSK-3b and PP2A regulate each other and control tau phosphorylation both directly and indirectly through each other.
25194152 Unceasing cell proliferation in the secretory phase of eutopic endometriosis is linked to deregulation GSK3beta signaling pathways.
25187518 GSK-3beta translocates from the cytosol to mitochondria in a kinase activity- and VDAC2-dependent manner in which an N-terminal domain of GSK-3beta may function as a mitochondrial targeting sequence
25183803 ER stress-PERK-GSK3alpha/beta signaling promotes proatherogenic macrophage lipid accumulation
25172662 Protocadherin 9 inhibits epithelial-mesenchymal transition and cell migration through activating GSK-3beta in hepatocellular carcinoma.
25157753 The over-expression of p-Ser9-GSK3B and type 2 diabetes mellitus are strongly correlated with worse surgical outcome of hepatocellular carcinoma.
25145299 CXCR4 promotes GSK3beta expression via the Akt cell signaling pathway in pancreatic cancer cells.
25141968 Results indicate that the SNPs in the selected regions of the GSK3b gene (rs3732361, rs56728675, rs60393216, and rs334558) did not confer the susceptibility of sporadic Alzheimer's disease in a cohort of southern Han Chinese population
25138042 findings suggest that Ser9-phosphorylated GSK3beta actively antagonizes cell apoptosis in a NF-kappaB dependent manner
25135221 an IL-1beta/IL-1RI/beta-catenin signaling pathway induces beta-catenin accumulation due to GSK3beta inactivation by Akt phosphorylation
25124796 The PKC/GSK-3beta signaling pathway controls both the stability and transcription of Snail, which is crucial for epithelial-mesenchymal transition induced by EGF in PC-3 and A549 cells.
25123268 Low expression of GSK3B was associated with renal cell carcinoma.
25114899 Studied conditions that increase the sensitivity of cancer cells to MK-2206. and found reduction by salinomycin of Akt and downregulation of pAkt, pGSk3beta, pTSC2, and p4EBP1 by cotreatment with MK-2206.
25088797 this is the first study to demonstrate that bFGF can induce EMT via AKT/GSK-3beta/Snail signaling pathway in prostate cancer cells.
25075421 The literature review contains data about functions of glycogen synthase kinase-3 beta (GSK-3 beta) in the cell and its role in the functioning of the nervous tissue, an analysis of current research on the participation of GSK-3 beta in the pathogenesis of affective disorders and schizophrenia and effect of psychotropic drugs on the activity of the kinase.
25069254 GSK-3beta -50T/C polymorphism and two haplotypes may be related to smoking behavior
25059120 Knockdown of Akt2 using siRNAs or the PI3K inhibitor Ly294002 inhibited TGF-beta1-induced phosphorylation of GSK3beta and expression of Snail1
25053419 Data indicate that glycogen synthase kinase 3 beta (GSK3beta) and transcription factors FOXO1/3/4 promote hepatoma cell proliferation through type I insulin-like growth factor receptor (IGF-IR).
25041379 GSK3B protein and mRNA expression were decreased in the dorsolateral prefrontal cortex and temporal lobe of bipolar disorder patients compared to schizophrenia patients and controls.
25010341 We found that the orientations that these compounds adopt inside GSK3beta binding site prioritize the formation of hydrogen bond (HB) interactions between the maleimide group and the residues at the hinge region
24994693 GSK3B gene may confer a genetic risk for Major Depressive Disorder. GSK3beta genotypic effect of rs6438552 and its interaction with dis status may contribute to the altered topological organization of resting state functional brain networks in MDD patients
24992082 This study demonistrated that genetic variants of the GSK-3[beta] gene could partially underlie the response susceptibility to lithium treatment in bipolar disorder.
24984063 GSK3A is redundant with GSK3B in regulating drug-resistance and chemotherapy-induced necroptosis
24982245 The subcellular redistribution of NAT10 can be induced by decreases in GSK-3b activity. This redistribution increases cancer cell motility, and is, thus, correlated with invasive potential and poorer clinical outcome
24939300 Findings suggest that inhibition of H19 long non-coding RNA (LncRNAH19) and miR-675 expression can promote migration and invasion of hepatocellular carcinoma (HCC) cells via AKT/GSK-3beta/Cdc25A signaling pathway.
24929931 The results demonstrate a complex interaction between tau and AICD involving activation of GSK3beta in promoting cell death, and the ability of Hirano bodies to modulate this process.
24929537 Our study demonstrates that GSK3B is unlikely to be associated with bipolar disorder risk. [meta-analysis]
24901984 NM1 phosphorylation by GSK3beta blocks NM1 ubiquitination by UBR5 and degradation by the proteasome, leads to NM1 association with the chromatin and promotes rDNA transcription activation at G1.
24899689 These studies support targeting GSK-3beta in myocardial fibrotic disorders and establish critical roles of cardiac fibroblasts in remodeling and ventricular dysfunction.
24854430 These findings indicate that GSK-3beta is important in the regulation of NF-kappaB and CREB activation in leukocytes under the metabolic condition of obesity.
24802394 After overexpression and knockdown of XIAP, the AKT, pAKT, JNK2 and GSK3beta levels were determined in periodontal ligament cells.
24779391 We conclude that the MAPT rs242562 is associated with PD in central China in the background of MAPT H1/H1 diplotype.
24760594 Results suggest that lithium chloride (LiCl) treatments activate alpha-tubulin N-acetyltransferase 1 (alphaTAT1) by the inhibition of glycogen synthase kinase 3 beta (GSK-3beta) and promote the alpha-tubulin acetylation, and then elongate the primary cilia.
24742671 These findings reveal the ability of GSK-3beta to modulate IL-22R protein stability that might have significant implications for cytoprotective functions and therapeutic targeting of the IL-22 signaling axis.
24704462 Interplay between GSK-3beta activation, histone H3 phosphorylation and DNA methylation directs proliferation of breast cancer cells.
24681994 the regulatory roles of GSK-3beta in dopaminergic neuron degeneration and in Parkinson's disease (Review)
24677591 significant association of the GSK3B copy number variations and bipolar disorder pointing out that the copy number and extension of the copy number variations varies among individuals
24677550 GSK3Beta is a key endogenous factor for regulating oligodendrogenesis from the dorsal subventricular zone under the control of Wnt-signaling.
24675460 TRAIL-induced apoptosis in pancreatic ductal adenocarcinoma cell lines is enhanced by pharmacological inhibition of glycogen synthase kinase-3 (GSK-3) or by shRNA-mediated depletion of either GSK-3alpha or GSK-3beta.
24634935 Octreotide treatment increased SSTR2,SSTR5-induced apoptosis of SW480 colon cancer cells via GSK3B/Wnt/CTNNB1 pathway.
24634145 Levels of total GSK3 were decreased in the Huntington disease-affected frontal cortex and this correlated with decreased phosphorylated CRMP2.
24626091 GSK3B activity affects cell response or sensitivity to mTOR kinase inibitors.
24577092 Sustained GSK3beta activity represses a critical regulatory step in the myogenic cascade, contributing to the undifferentiated, proliferative phenotype in alveolar rhabdomyosarcoma.
24571487 The AKT/GSK-3beta signaling pathway is activated in lung cancer cells following inhibition of mTORC1.
24549719 GSK-3beta could be phosphorylated at Ser9 and its activity was inhibited when C6 glioma cells were treated by lithium chloride
24535599 Grb14-insulin receptor interaction is regulated in part by GSK-3 activity.
24531650 GSK3b activation contributes to liver injury by participating in oxidative stress response in acute liver failure and is, therefore, a potential therapeutic target for acute liver failure.
24507683 Studied the expression of phosphatidylinositol 3 kinase (PI3-K), protein kinase B (PKB) and glycogen synthase kinase 3 beta (GSK-3 beta) in skeletal muscle tissue of gestational diabetes mellitus patients.
24486183 genetic association study in population in Spain: Data suggest 2 SNPs in GSK3B (rs1732170, T allele; rs334558, G allele; not rs11921360) are associated with increased impulsivity in bipolar patients; SNP in GSK3A (rs3745233) shows no association.
24468793 TBK1 signaling regulates radiation-induced epithelial-mesenchymal transition by controlling GSK-3beta phosphorylation and ZEB1 expression.
24451375 Wnt stimulation induced prolonged monoubiquitination of Gsk3beta and Gsk3beta-beta-TrCP interaction.
24427901 There is no significant relationship between the polymorphism of GSK-3beta -1727A/T and the nicotine addicts
24425879 Both pHLXB9 and active GSK-3beta are elevated in beta cells with menin knockdown, in MEN1-associated beta cell tumors (insulinomas)
24411062 In bipolar disease patients, the most predominant pathway which was associated with the altered molecules was the GSK3beta signalling pathway linked to growth factor activity.
24398687 A colon cancer-derived mutant of Kruppel-like factor 5 (KLF5) is resistant to degradation by glycogen synthase kinase 3beta (GSK3beta) and the E3 ubiquitin ligase F-box and WD repeat domain-containing 7alpha (FBW7alpha).
24391509 these results suggest that GSK3b inhibition by NCYM stabilizes the MYCN protein both in vitro and in vivo.
24390485 FOXL2 C134W mutation affects granulosa cell tumor development via differential posttranslational modifications of FOXL2 by GSK3B.
24334212 Associations were confirmed between AD and platelet GSK3beta activity, lymphocyte CREB activity and plasma BDNF. CREB activity and platelet BDNF concentration seems to be related to depressive disorder.
24333432 Experimental data revealed that inhibition of GSK3beta could increase HIF1alpha protein levels and expression of its target genes by increasing the stability of the HIF1alpha mRNA.
24327518 Data indicate autophagy induction due to GSK-3 inhibition (GSK-3beta)in renal cancer cells.
24316184 Together, these results show that GSK3 regulates mitochondrial biogenesis induced by glycolysis inhibition.
24312592 GSK-3 was important for glioma cell invasion and localized inhibition of GSK-3beta was critical for cell polarity formation
24303084 Galectin-3 silencing inhibits epirubicin-induced ATP binding cassette transporters and activates the mitochondrial apoptosis pathway via beta-catenin/GSK-3beta modulation in colorectal carcinoma.
24282277 Data indicate glycogen synthase kinase 3-mediated regulation of MYCN mRNA levels through p53 tumor suppressor protein.
24239461 ERK, AKT, and GSK-3beta have roles in boldine-induced cell cycle arrest and apoptosis in T24 human bladder cancer cell line
24228880 new evidence for the involvement of GSK-3beta in endothelial cell activation.
24227837 GSK-3beta inhibitors 6BIO, 6BIOder, and 18BIOder have neuroprotective effects on Tat induced cell death in rat mixed hippocampal cultures
24188406 These results imply that curcumin inhibits Ab-induced tau hyperphosphorylation involving PTEN/Akt/GSK-3b pathway.
24158777 In this review, the function of GSK3B in the nervous tissue is associated with neural development, neuron polarization, and neurodegeneration.
24150227 GSK3beta genotype predicted rhythm effects of lithium, specifically among bipolar disorder cases.
24142875 RNPC1 is phosphorylated at Ser195 by glycogen synthase kinase 3 (GSK3) and GSK3 promotes p53 mRNA translation through phosphorylation of RNPC1
24134204 DYRK1B is a novel Thr(286)-CCND1 kinase that acts independently of GSK3beta to promote CCND1 degradation.
24132507 Sodium palmitate-induced lipoapoptosis in human liver L02 and HepG2 cells was regulated by GSK-3beta activation, which led to JNK activation and Bax upregulation.
24117074 Its signal plays a crucial role in tumor genesis and tumor progression by promoting cell proliferation and inhibiting apoptosis.
24112793 It would modify genetic risk for amyloid plaque pathology.
24065186 these results revealed that 14-3-3beta regulates the proliferation of astrocytes and glioma cells through the GSK3beta/beta-catenin signaling pathway.
24038789 SDF1 exerts a quiescent effect on resident c-kit(+) CSPCs by decreasing CK1alpha levels, increasing GSK3b activity, stabilizing b-catenin, and affecting regulation of the cell cycle through Bmi-1 and cyclin D1.
24035907 GSK-3 expression and regulation in human neutrophils, was investigated.
24027432 co-expressing COP1 and active GSK3beta blocked in vitro cell growth/migration and in vivo metastasis of invasive breast cancer cells.
24025791 glycogen synthase kinase 3 beta knockdown suppressed the upregulation of DRP1 induced by elevated pressure.
24022664 the interaction between LKB1 and GSK3beta upregulates GSK3beta activity to suppress WNT-induced cell proliferation in esophageal carcinoma cells.
24001613 Data indicate that PYK2 N-terminal domain interacting receptor 1 (Nir1) could induce epithelial-mesenchymal transition by stabilising Snail via the PI3K/Akt/GSK3beta/Snail signalling pathway through binding to CCL18.
24000012 GSK3beta loss-of-function resulted in reduced RACK1 activity. RACK1 contributes to THP1 cell proliferation through, at least partially, enhancing GSK3beta activity.
23983127 Data indicate that succinate dehydrogenase 5 (SDH5) functions as a critical protein in regulating epithelial-mesenchymal transition (EMT) by modulating the glycogen synthase kinase (GSK)-3beta-beta-catenin signaling pathway.
23959174 Furthermore, our study reveals that high expression of RPN2 and concomitant accumulation of mtp53 were associated with cancer tissues in a small cohort of metastatic breast cancer patients.
23951236 GSK3B and MAPT polymorphisms are associated with grey matter and intracranial volume in healthy individuals.
23912036 GSK-3beta inhibitors 6BIO, 6BIOder, and 18BIOder have neuroprotective effects on Tat induced cell death in rat mixed hippocampal cultures
23911749 Over-expression of GSK3beta rescued osteogenesis in TNF-alpha-stimulated PDLSCs.
23905999 In the brains of transgenic mice overexpressing GSK-3Beta a reduction of metabolic activity was seen in different brain regions.
23900020 These results indicate that histamine inhibits sweat gland secretions by blocking ACh-induced inactivation of GSK3beta.
23896637 this studydemonstrated abundant levels of the critical negative cell-cycle regulators, p27(Kip1), its phosphorylated form, p-p27(S10), p18Ink4c, and GSK-3, in beta-cells of both adult human and mouse pancreatic islets, which contribute to maintenance of beta-cell quiescence.
23880761 Progesterone receptor A stability is mediated by glycogen synthase kinase-3beta in the Brca1-deficient mammary gland.
23874688 GSK3beta inactivation may account for EZH2 overexpression and subsequent tumour progression, and this mechanism might be a potential target for nasopharyngeal carcinoma therapy.
23853095 PASK phosphorylates and inactivates GSK3beta, thereby preventing PDX-1 serine phosphorylation and alleviating GSK3beta-mediated PDX-1 protein degradation in pancreatic beta-cells.
23851680 GSK-3beta may act as an upstream regulator for NF-kappaB activation in anti-dengue-virus NS1 Ab-induced ceramide signaling.
23851495 High GSK3beta is associated with epithelial-mesenchymal transition and tumor metastasis by controlling CHIP-mediated degradation of Slug.
23846217 GSK3B activity is necessary for the apoptotic pathway induced by Celastrol.
23845472 We report a protein expression profile in high-grade osteosarcoma associating beta5 integrin, FAK, and GSK3beta that significantly correlates with poor response to neoadjuvant chemotherapy.
23824844 Inhibition of GSK-3beta by Wnt3a does not inhibit, but modestly stimulates, CCN2/CTGF levels.
23818587 Dysregulation of PAD4-mediated citrullination of nuclear GSK3beta activates TGF-beta signaling and induces epithelial-to-mesenchymal transition in breast cancer cells.
23811558 GSK-3beta inhibitors 6BIO, 6BIOder, and 18BIOder have neuroprotective effects on Tat induced cell death in rat mixed hippocampal cultures
23798682 GSK3alpha, GSK3beta, and MAPK13 were found to be the most active tau kinases, phosphorylating tau at all four epitopes.
23784143 GSK-3beta inhibitors 6BIO, 6BIOder, and 18BIOder have neuroprotective effects on Tat induced cell death in rat mixed hippocampal cultures
23768967 In this review, GSK-3beta has a role in the signaling pathways linked to gliomagenesis in glioblastoma multiforme.
23761130 LZTS2 could inhibit cell proliferation and cell cycle transition at the G1/S phase and was implicated in the regulation of proteins associated with the canonical Wnt pathway, including GSK3B and beta-catenin through inactivating the Akt pathway.
23729362 GSK3B is significantly more activated in drug-resistant versus responsive patients.
23685991 phosphorylates IRF3 linker region
23673211 activation of the Wnt/beta-catenin signaling pathway and upregulated survivin expression due to cytoplasmic GSK-3beta inhibition might lead to cisplatin resistance in NSCLC
23669633 Synthesis and biological evaluation of 3-benzisoxazolyl-4-indolylmaleimides as potent, selective inhibitors of glycogen synthase kinase-3beta.
23649588 GSK3B plays a central role in determining and maintaining the phenotypes and behavior of cancer stem cells.
23628795 GSK3-beta polymorphisms didn't affect Parkinson's disease risk in the Caucasian population.[meta-analysis]
23623971 GSK3 regulates Nrf1 expression and cell survival function in response to stress activation.
23621307 The involvement of GSK-3 in several key pathophysiological pathways leading to AD and neurodegenerative diseases has placed this enzyme in a central position in this disorder.
23615537 results suggest that c-Src suppression by PP2 or siRNAs may regulate the progression of cell cycle through AKT/GSK3beta and ERK1/2 pathways
23614534 Our data suggest that GSK-3beta is an additional desmoid-type fibromatosis marker with an important role in the aetio-pathogenesis of this entity.
23598903 GSK-3beta variation(including single-nucleotide polymorphism in GSK-3beta (rs12630592)is implicated in multiple phenotypes relevant to schizophrenia
23583197 Data indicate that the chimeric protein is a direct inhibitor of GSK3beta in a Akt phosphorylation-dependent manner.
23582741 Data indicate that Fas signalling inactivates GSK-3beta by ERK/MAPK signalling, leading to nuclear accumulation of Snail and beta-catenin.
23559006 GSK-3beta signaling is a key mechanism in regulating autophagy activation or inclusion formation in human tumor or non-tumor breast cells, respectively.
23551536 Both Wnt1 and GSK3beta were detected predominantly in the cytoplasm of invasive breast tumour cells and the in-situ component, while GSK3beta was also detected in stromal fibroblasts.
23525328 interactions between the GAB2 and GSK3B polymorphisms and the well-established genetic factor APOE may modify the overall risk of Alzheimer disease.
23505128 Several proteins including hnRNPK, PCNA, Ezrin and STAT1, have been confirmed to interact with GSK-3beta1 by co-immunoprecipitation in HepG2 cells.
23463670 sorafenib reduced the stability of the Mcl-1 protein by enhancing its ubiquitination and degradation by the proteasome via the AKT/GSK3beta and the ERK pathways.
23453640 results suggest that genetic variability at rs669838-IMPA2,rs4853694-INPP1, rs1732170-GSK3b and rs11921360-GSK3b genes is associated with a higher risk of attempting suicide in bipolar patients.
23442801 findings suggest GSK3beta activity is required for hBora-mediated mitotic entry through Ser274 and Ser278 phosphorylation
23440732 Glycogen synthase kinase 3beta promoter inactive mutant rs334558 may contribute to the development of schizophrenia not bipolar disorder.
23432902 The phosphorylation of GSK3beta was up-regulated in cirrhotic patients with hepatocellular carcinoma (HCC) vs. patients without tumor.
23413973 Our findings suggest that the bipotential, PS/mesendoderm-like cell population exists only at the initial stages of GSK-3 inhibition, whereas long-term inhibition results in an endodermal fate
23408967 targeting of GSK3beta represents an effective strategy to overcome the dual challenges of invasiveness and treatment resistance in pancreatic cancer
23408424 Extracellular signal-regulated kinase and glycogen synthase kinase 3beta regulate gephyrin postsynaptic aggregation and GABAergic synaptic function in a calpain-dependent mechanism
23402899 Timely targeting of glycogen synthase kinase-3beta arrests the pathology and memory deficits in an Alzheimer's transgenic mouse model.
23389968 results suggest that nuclear expression of GSK-3beta and loss of membrane beta-catenin identify a subset of colon carcinomas with worse prognosis
23389291 data demonstrate that GSK-3beta plays an important role in regulating tRXRalpha production by calpain II in cancer cells
23379509 Studies indicate that DISC1 and AKT were invlved in the regulation of GSK3beta and Wnt signaling paathway.
23369789 Studies indicate the therapeutic potential of GSK-3 inhibitors for treatment of neurodegenerative and behavior disorders.
23352529 GSK-3 may play a crucial role in the inflammatory process in chronic rhinosinusitis with nasal polyps (CRSwNP).
23349801 Data indicate that the phosphorylation of GSK-3beta was reduced by siRNA of PKCdelta, PKCepsilon, and PKCzeta.
23328640 GSK-3beta signaling plays an important role in the pathogenesis of hyperoxia-induced neonatal lung injury.
23314850 SLIT2 suppresses colon tumor metastasis, and it exerts its suppressive activity against colorectal cancer metastasis by restraining AKT-GSK3beta signaling.
23301033 GSK-3beta inhibitors 6BIO, 6BIOder, and 18BIOder have neuroprotective effects on Tat induced cell death in rat mixed hippocampal cultures
23288365 Inhibition of GSK-3beta during ex vivo expansion of human bone marrow mesenchymal stromal cells may enhance their migration capacity.
23279147 In AD [Alzheimer's Disease] patients, the mRNA expression level of the GSK-3beta gene is increased and may be related to age and behavioural pathology in AD [Alzheimer's Disease].
23277198 GSK3beta phosphorylates cMyBP-C on a novel site, Ser133 in the proline-alanine-rich region and increases kinetics of force development, suggesting a noncanonical role for GSK3beta at the sarcomere level.
23243017 Findings suggest that inhibiton of Bcl-2, Bcl-xL and PI3K, and release of Bim from Bcl-2/Bcl-xL and GSK3alpha/beta culminating in Bax/Bak activation and apoptosis.
23211630 These results suggest that ROCK2 might mediate bFGF-induced proliferation of SH-SY5Y cells through GSK-3beta and beta-catenin pathway
23202730 These data provide evidence for regulation of BACE1 expression and AD pathogenesis by GSK3beta and that inhibition of GSK3 signaling can reduce Abeta neuropathology and alleviate memory deficits in AD model mice
23192081 Activation of GABA(B) receptors significantly inhibits Akt/GSK-3 signaling in a beta-arrestin-dependent pathway.
23185298 GSK3beta-mediated phosphorylation at Ser693 of Drp1 may be associated with mitochondrial elongation.
23185275 Deletion analysis of CRMP-2 identified a 51 amino acid sequence in the C-terminus that is required for targeting to the basal body and primary cilium. This domain contains GSK-3beta phosphorylation sites.
23184735 The present molecular dynamic simulations have provided an insight into the inhibitory mechanism of GSK3B by the replacement of Mg2+-1 by Ca2+ at the atomic level.
23166798 The level of cellular glycogen synthase kinase 3beta (GSK3beta) is downregulated by sidestream cigarette smoke exposure.
23164673 Cinobufagin reduced expression of p65, increased expression of GBK-3beta, and induced apoptosis in osteosarcoma cells.
23160194 cyclin D3 is reduced in myotonic dystrophy due to increased phosphorylation at T283 by GSK3beta, which triggers the degradation of cyclin D3.
23110823 This study demonistrated that GSK-3beta mRNA levels were significantly decreased in the PFC but not in the hippocampus of teenage suicide victims compared to controls.
23104438 Kap beta2 imports GSK-3beta through its putative PY nuclear localization signal motif from the cytoplasm to the nucleus and increases its kinase activity.
23085750 GSK3beta phosphorylation of the KLF6 tumor suppressor promotes its transactivation of p21.
23077641 GSK-3beta inhibitors 6BIO, 6BIOder, and 18BIOder have neuroprotective effects on Tat induced cell death in rat mixed hippocampal cultures
23077590 Using GSK3 inhibitors and siRNA knock-down, we demonstrate that the mechanism of riluzole-induced Smad phosphorylation involved GSK3b
23047923 GSK-3beta inhibitors 6BIO, 6BIOder, and 18BIOder have neuroprotective effects on Tat induced cell death in rat mixed hippocampal cultures
23030648 GSK3beta polymorphisms may play an important role in MDD endophenotypes, especially in anxiety symptoms.
23023215 GSK3beta was downregulate in all samples and CREB3 did not show a significant decrease or increase in its mRNA expression, but the results were significant in mucoepidermoid carcinoma and salivary duct carcinoma.
23021822 GSK-3beta genetic variants may be associated with the risk of bipolar I disorder, age of disease onset in females, and the therapeutic response to lithium
23010592 The expression levels of NOK, p-Akt(Thr308) and p-GSK-3beta(Ser9) were positively correlated in cancerous and non-cancerous breast cell lines.
23002080 Chronic circadian disruption by light-at-night via occupational exposure or age-related sleep disturbances may contribute to cancer incidence and the metastatic spread of breast cancer by inhibiting GSK3beta activity.
22999923 Our observations indicate that the R280T mutation of p53 regulates the proliferation of human glioma cells related to the GSK-3beta/PTEN pathway.
22990942 The less active GSK3-beta rs334558*C gene promoter variant is associated with increased white matter microstructure pathology in bipolar disorder.
22976805 We suggest that analysis of both GSK3b and cyclin D1 expressions can be considered as a marker of good prognosis in early breast cancer.
22970250 Taken together, the GSK3B, CTNNB1 and NOTCH2 expression signature is a novel, promising prognostic parameter for gastric cancer
22965877 Data propose that NUB1, by regulating GSK3beta levels, modulates tau phosphorylation and aggregation, and is a key player in neurodegeneration associated with tau pathology.
22960426 GSK3beta chemical inhibition results in HNF4alpha DNA binding impairment while a constitutively active GSK3beta mutant impairs the TGFbeta-induced inhibitory effect on HNF4alpha tumor suppressor activity.
22936801 ASPP 049 from C. comosa induced osteoblastic cell proliferation and differentiation through ERalpha-, Akt-, and GSK-3beta-dependent activation of beta-catenin signaling.
22933777 Semaphorin (Sema)3A induces formation of the GSK3beta/axin-1/beta-catenin complex, which regulates the signaling cascade of Sema3A via an endocytotic mechanism in dorsal root ganglion neurons.
22910909 Hyperphosphorylation of Tau induced by naturally secreted amyloid-beta at nanomolar concentrations is modulated by insulin-dependent Akt-GSK3beta signaling pathway.
22898789 Desmoplakin and pGSK3beta constitute independent good prognostic factors for progression free survival in Ewing Sarcoma patients.
22863953 Glycogen synthase kinase 3beta inhibition prevents monocyte migration across brain endothelial cells via Rac1-GTPase suppression and down-regulation of active integrin conformation.
22855295 Endothelial vascular cell morphogenesis is mediated by modulation of GSK3beta activity.
22834106 Found that GSK-3beta-50T/C may be linked with the effect of lithium treatment in Japanese bipolar patients.
22832604 Short Disrupted-in-Schizophrenia (DISC)1 splice variants show reduced or no binding to nudE nuclear distribution E homolog (NDEL)1 and phosphodiesterase (PDE)4B proteins but fully interact with fasciculation/ elongation zeta (FEZ)1 and GSK3beta proteins.
22832527 Cross-species co-expression of GSK3B is one of the most consistent and conserved covariates of neurexin 1 (NRXN1).
22825252 Gsk3 suppresses canonical Wnt activity in human pluripotent stem cells (PSCs) but not murine PSCs.
22815195 rs334558 Variant in GSK3beta reduces the risk of Parkinson's disease in a Han Chinese population from mainland China.
22814751 Results demonstrate that integrin outside-in signaling and platelet spreading requires Src family kinase-dependent and ADP receptor-amplified activation of the PI3K-Akt-GSK-3beta pathway.
22810307 We have, to our knowledge, demonstrated a previously unreported role for GSK3beta in modulating the motile and invasive behavior of melanoma cells through N-cadherin and FAK.
22785398 clinically significant proportion of resting-state brain function variation in amnesic mild cognitive impairment patients may be explained by genetic variation at the GSK-3betars334558 locus in ways that are distinguishable from controls.
22775567 Inhibition of GSK-3beta in somatic stem cells enhances their neural differentiation.
22773696 phospho-GSK-3beta/beta-catenin signaling regulates alpha-smooth muscle actin expression, a marker of myofibroblast differentiation, in vitro and in vivo.
22771494 Study propose that GC-dependent transcriptional activation requires functional GSK3beta signaling and that altered GSK3beta activity influences cell response to GC.
22751928 Two-dimensional gel electrophoresis and site-directed mutagenesis were used to identify two serines of NRF2 that are phosphorylated by glycogen synthase kinase 3 beta (GSK-3 beta) in the sequence DSGISL.
22732552 GSK-3beta can inhibit PP2A by increasing the inhibitory L309-demethylation involving upregulation of PME-1 and inhibition of PPMT1
22710716 A novel mechanism by which mitosis progression and chromatid cohesion are regulated through GSK3/SCF(FBXW7)-mediated proteolysis of JunB.
22707636 These results indicated that inactivation of GSK-3beta plays a pivotal role in the TNF-alpha-mediated tumorigenesis of renal cell carcinoma .
22690042 Activated protein C induced endoplasmic reticulum stress and attenuated lipopolysaccharide-induced human umbilical vein endothelial cell apoptosis mediated by glycogen synthase kinase-3beta.
22687243 analysis of regulation of AKT and GSK-3beta by O-GlcNAcylation in various types of cells
22679108 GSK-3 regulates proliferation and morphology of melanoma through phosphorylation and increased levels of PAX3 that directly interacted with a number of GSK-3b residues
22661511 Aldose reductase mediates changes in GSK3B phosphorylation via PKC/Akt pathway during myocardial ischemia-reperfusion injury.
22658982 results suggest that the -1727A/T SNP of GSK-3beta gene may affect susceptibility in ADHD.
22586270 phosphorylation of additional adjacent serine residues by glycogen synthase kinase 3beta maximizes ERbeta sumoylation
22577147 Specific serine-proline phosphorylation and glycogen synthase kinase 3beta-directed subcellular targeting of stathmin 3/Sclip in neurons
22539723 glycogen synthase kinase-3 (GSK3), when deinhibited by default in cells deprived of growth factors, activates acetyltransferase TIP60 through phosphorylating TIP60-Ser86, which acetylates and stimulates the protein kinase ULK1, which is required for autophagy
22539113 GSK-3beta is more important in high Gleason score tumors, where it could be driving androgen-independent androgen receptor activation and/or activating other signals, such as those involving Akt.
22534782 GSK-3beta activity appears to promote the growth of osteosarcomas via the NF-kappaB pathway. GSK-3beta activity is positively associated with clonogenicity and tumorigenicity and is critical for cell survival in osteosarcoma.
22514281 These results indicate that phosphorylation of ZAP by GSK3beta modulates ZAP activity.
22460328 data suggest an essential role of Bip in GSK-3beta dependent tau hyperphosphorylation in endoplasmic reticulum stress by promoting the binding of GSK-3beta to tau
22455883 Positive correlations are found between p-AKT, p-GSK3beta and beta-catenin in epithelial ovarian carcinoma. The activation of beta-catenin is possibly correlated with inactivation of p-GSK3beta that binds to p-AKT.
22419736 Data indicate that the neuronal adenylate kinase-1 (AK1) is induced by Abeta(42) to increase abnormal tau phosphorylation via AMPK-GSK3beta and contributes to tau-mediated neurodegeneration.
22419096 role of GSK3beta in Pdcd4 expression lung cancer cells
22413565 There was no significant difference in the frequency of GSK3B -50T/C and -1727A/T polymorphisms between alcoholics and controls. We suggested that there was no significant association of GSK3B -50T/C and -1727A/T polymorphisms with alcoholism.
22384031 GSK3 inhibitor-BIO regulates proliferation of immortalized pancreatic mesenchymal stem cells
22363707 GSK3beta-dependent phosphorylation of LCRMP-1 provides an important mechanism for regulation of LCRMP-1 on cancer cell invasiveness and clinical outcome.
22349353 Kisspeptin-10 inhibits the migration of human placental trophoblast-derived HTR8SVneo cells by stimulating complex ERK1/2-p90rsk-GSK3 beta-FAK feedback interactions.
22286758 NF-kappaB activation by sorafenib requires glycogen synthase kinase 3beta activation.
22262776 Data indicate that GSK3 inhibitors may be of therapeutic value in selectively targeting leukemia-initiating cells in combination with imatinib mesylate (IM), but not dasatinib.
22262180 GSK3b interacts with and phosphorylates BCL2L12 and might also affect BCL2L12A to modulate the apoptosis signaling pathway.
22246236 Migfilin promoted beta-catenin degradation by reinforcing the association between beta-catenin and GSK-3beta.
22243669 There might be a positive correlation between either inflammatory cell infiltration or interstitial fibrosis/tubular atrophy and high GSK-3beta expression in renal allograft tissue
22234583 Resveratrol down-regulates the protein cyclin D1 and, in a concentration dependent manner, the phosphorylation levels of protein kinase B and glycogen synthase kinase-3beta in OVCAR-3 ovarian cancer cells.
22214783 Suppression of GSK-3beta activity, through specific inhibitors, dramatically down-regulated amyloid-beta protein (Abeta) generation in human SH-SY5Y and SH-SY5Y-AbetaPP695 cells by enhancing AMPK activity to down-regulate Abeta.
22201186 study undertaken to provide further support for a role of GSK3 in pancreatic cancer cell growth and to identify new cellular and molecular mechanisms involved; activation of the c-jun N-terminal kinase pathway is necessary for the GSK3 inhibition-mediated increase in Bim expression and apoptotic response
22193544 Glycogen synthase kinase 3beta (GSK3beta) has a vital role in Tau hyperphosphorylation at its microtubule-binding domains.
22184106 a novel role of Pin1 in inhibiting GSK3beta kinase activity to reduce APP protein levels, providing a previously unrecognized mechanism by which Pin1 protects against Alzheimer disease.
22179823 GSK3beta is a mediator of NPM-ALK oncogenesis
22144179 A new pathway that could be targeted at the level of GSK-3, Fbw7, or USP28 to influence HIF-1alpha-dependent processes like angiogenesis and metastasis.
22142472 GSK-3beta inhibits full activation of STK38, and STK38 activation is required to prevent cell death in response to oxidative stress
22140263 Thus, GSK-3beta negatively regulates myeloid cell IL-10 production in response to leishmania.
22102280 Evidence for irreversible inhibition of glycogen synthase kinase-3beta by tideglusib.
22093618 demonstrate low miR-199a expression as a feature of advanced RCCs, identify miR-199a as a negative regulator of GSK-3beta
22087308 DNA damage stress with simultaneous inhibition of the kinase activity causes degradation of Jak2 or Jak2-V617F by caspase cleavage and proteasomal degradation through GSK3beta activation, which is closely involved in synergistic induction of apoptosis
22048123 The in vivo findings presented here demonstrate for the first time the therapeutic potential of P2X7R antagonism in the treatment of familiar Alzheimer's disease (FAD).
22039301 GSK3beta is an essential antiapoptotic factor in both neopastic and nontransformed primary human mast cells
22039048 Adiponectin stimulates proliferation of adult hippocampal neural stem/progenitor cells through activation of p38 mitogen-activated protein kinase (p38MAPK)/glycogen synthase kinase 3beta (GSK-3beta)/beta-catenin signaling cascade.
21996267 findings suggest that GSK3beta is likely a risk gene for schizophrenia, and its expression alteration caused by the risk SNP in the promoter region may contribute to the etiology of schizophrenia
21898401 Suggest that interferon-alpha induced depression depends on GSK3B controlled serotonin uptake.
21887250 FGF2 and EGF affect the motor neuron fate decision in human fetal neural stem cells differently through a fine tuning of the PI3K/AKT/GSK3beta pathway.
21873331 GSK-3 is a key regulator of the canonical Wnt signalling in fibroblasts
21821001 the link between GSK-3b and galectin-3 is important for chronic myeloid leukemia cells to apoptotic stimuli.
21795403 These data reveal an as-yet-unknown mechanism by which GSK3beta controls cell survival
21790007 these results suggest that the expression levels of GSK3B can't serve as a biomarker for early stages of PD.
21757741 a strong correlation between securin accumulation and GSK3beta inactivation was observed in breast cancer tissues, indicating that GSK3beta inactivation may account for securin accumulation in breast cancers.
21737790 beta isoform-specific transgenic inhibition of GSK-3 exacerbates ischemic injury but protects against ischemia-reperfusion injury by modulating mammalian target of rapamycin (mTOR) signaling and autophagy.
21725365 Data show that glycogen synthase kinase 3beta (GSK3beta) as a promising target for leukemic stem cell therapy and reveal gender differences as a parameter in anti-leukemia therapy.
21700708 Inducible nitric-oxide synthase and nitric oxide donor decrease insulin receptor substrate-2 protein expression by promoting proteasome-dependent degradation in pancreatic beta-cells: involvement of glycogen synthase kinase-3beta.
21671254 GSK3-beta seems not to play a role in tau hyperphosphorylation at T(181). Specific kinase inhibitors were unable to prevent MT-2 supernatant-mediated neurite retraction.
21661417 STAT3 and beta-catenin signaling pathway may affect GSK-3beta expression in hepatocellular carcinoma.
21632881 mindin serves as a novel mediator that protects against cardiac hypertrophy and the transition to heart failure by blocking AKT/GSK3beta and TGF-beta1-Smad signalling.
21613824 Data show that overexpression of GSK-3beta hindered troglitazone-induced cell growth inhibition and NFkappaB inactivation.
21609933 Though APC and CTNNB1 regulation by GSK3B are frequently disrupted by mutations in colon cancers, our observations suggest that increased functional GSK3B might drive other growth-promoting signals in colorectal tumorigenesis.
21571466 Inactivation of GSK-3beta might be important for nasopharyngeal carcinoma tumorgenesis through negatively regulating PMS2 production
21549170 study suggests that GSK3beta polymorphisms are not associated with bipolar disorder. However, the GSK3beta SNP -1727A/T is associated with age of onset and presence of psychotic symptoms in bipolar disorder
21527318 GSK3beta rs334558 is a susceptibility factor for multiple sclerosis
21514616 GSK-3beta inhibitors 6BIO, 6BIOder, and 18BIOder have neuroprotective effects on Tat induced cell death in rat mixed hippocampal cultures
21471285 treatment with linifanib reduces phosphorylation of Akt and glycogen synthase kinase 3beta (GSK3beta)
21460223 Age-dependent accumulation of soluble amyloid beta oligomers reverses the neuroprotective effect of soluble amyloid precursor protein-alpha by modulating phosphatidylinositol 3-kinase/Akt-GSK-3beta pathway in Alzheimer mouse model.
21443865 The results of this study suggested that the functional polymorphisms in GSK3B promoter may be involved in the risk of developing sporadic later onset Alzheimer's disease in Han Chinese.
21441955 demonstrate that mutant K-Ras enhances ETS2 loading onto the promoter, and ETS requires its transcriptional activity to increase GSK-3beta gene transcription in pancreatic cancer cells
21436692 Overexpression of glycogen synthase kinase-3 beta in ovarian carcinoma cells is associated with acquired paclitaxel resistance.
21435461 mammalian cells are sensitized to GSK-3beta inhibitors and growth impairment by nutritional limitation
21422248 These studies identify the molecular mechanism by which mTORC1 affects GSK3
21343617 in response to cellular stress, GSK-3beta restrains mTORC2-Akt signaling by specifically phosphorylating rictor, thereby balancing the activities of GSK-3beta and Akt, two opposing players in glucose metabolism
21334395 GSK3 is involved in the early TLR4-mediated pro-inflammatory response in patients with decompensated cirrhosis.
21328461 GSK-3beta is an upstream regulator of the ACSL family of enzymes and of lipid accumulation in hepatocytes
21317289 Dual Phosphorylation of suppressor of fused (Sufu) by PKA and GSK3beta regulates its stability and localization in the primary cilium.
21314327 This is the first study to demonstrate a significantly higher GSK3B activity in drug-free patients with late-life depression.
21303975 RKIP/GSK3 axis is both a potential therapeutic target and a prognosis-based predictor of cancer progression.
21278490 p27 down regulation following GSK-3 depletion / inactivation plays a critical role in promoting beta-cell replication.
21238544 GSK3beta-mediated presenilin-1 phosphorylation inhibits amyloid beta precursor protein (APP) cleavage by gamma-secretase activity and decreases total amyloid production, whereas it increases the amyloid beta 42/40 ratio.
21228102 GSK3beta inactivation in podocytes results in decreased phosphorylation of p70S6K accompanied by cytoskeletal rearrangements and inhibited motility.
21217772 Data show that RelB is inducibly phosphorylated by GSK-3beta, indicating a direct substrate-enzyme relationship.
21212533 This study found that GSK-3beta2 has lower phosphorylation activity to tau at than GSK-3beta1 in cells, whereas the two variants exhibit equivalent levels of phosphorylation activities to amyloid precursor protein.
21204008 GSK-3beta activation is a downstream event for PGRN signaling
21189258 TGF-beta1 induced glycogen synthase kinase-3beta (GSK-3beta) phosphorylation on Ser-9 in HKC-8 cells, lead to its inactivation
21179545 CRMP4 is a key physiological substrate of GSK3 in regulating chromosomal alignment and mitotic progression through its effect on spindle microtubules
21160051 The ability of interferon (IFN)-beta to suppress GSK3-beta is a critical intracellular signaling event required for IFN-beta to induce interleukin (IL)-10 from dendritic cells.
21159074 In the Caucasian patient-control series examined, risk for Parkinson disease is influenced by variation in alpha-synuclein and tau proteins but not GSK-3 beta.
21145761 regulates IRF3 transcription factor-mediated antiviral response via activation of the kinase TBK1
21130530 The C,C and T,C haplotypes of GSK3B are moderately associated with increased risk and protection, respectively, for late onset Parkinson's disease.
21115199 no association between SNPs and affective temperament
21110852 inhibition of GSK-3beta downregulates the NF-kappaB activation pathway, leading to suppression of the expression of an NF-kappaB-regulated gene and promotion of apoptosis in acute lymphoblastic leukemia cells
21105670 GSK3beta autophosphorylation at residue Tyr(216) results in widening of the catalytic groove, thereby facilitating substrate access.
21061060 These results suggest that tau phosphorylation and GSK-3beta activation may not be essential for adult subventricular zone neurogenesis.
21038412 Identification of a GSK-3beta-CEBP alpha circuitry whose dysfunction may contribute to the development of human hepatocellular carcinoma.
20962236 GSK-3beta inhibitors 6BIO, 6BIOder, and 18BIOder have neuroprotective effects on Tat induced cell death in rat mixed hippocampal cultures
20934407 These results demonstrate that enzastaurin suppresses NK cell activity and may therefore interfere with NK cell-mediated tumor control in enzastaurin-treated cancer patients.
20920357 in multiple myeloma cells GSK-3alpha and beta play distinct roles in cell survival and modulate the sensitivity to proteasome inhibitors
20889919 GSK-3 contributes to urothelial cancer cell proliferation and survival, and is a potential therapeutic target in human bladder cancer.
20864106 PTEN selectively inhibits expression of VCAM-1 but not ICAM-1 through modulation of PI3K/Akt/GSK-3beta/GATA-6 signaling cascade in TNF-alpha-treated endothelial cells
20849862 Cdc42, by inhibiting GSK-3beta, markedly improves the angio-architecture and lumenization of neovessels induced by VEGF.
20848477 this study has identified GSK3-b as a central regulatory molecule of the inflammatory response in chronic intestinal inflammation.
20831597 Phosphorylation of proteins in the brain associated with Alzheimer's disease is altered in cortical tissue lacking transgenic glycogen synthase kinase-3alpha and -3ss.
20818790 GSK-3beta inhibitors 6BIO, 6BIOder, and 18BIOder have neuroprotective effects on Tat induced cell death in rat mixed hippocampal cultures
20800594 the blockage of the GSK-3beta-beta-catenin pathway resulting from the knockdown of ASK1 modulates the migration of breast cancer cells.
20709358 Evidence of glycogen synthase kinase 3beta inactivation was found in approximately half of the invasive mammary carcinomas.
20682308 The brain-derived neurotrophic factor (BDNF)-GSK3B interaction may modify the relationship between negative life events and major depressive disorder in the Chinese population.
20682308 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20679343 Spectroscopic studies of GSK3{beta} phosphorylation of the neuronal tau protein and its interaction with the N-terminal domain of apolipoprotein E.
20649541 GSK3 is one of the key modulators of metabolic alteration, leading the cells to senescence [review]
20648061 This review points out how, in contrast to the ubiquitously expressed GSK3beta1 isozyme, GSK3beta2 is expressed specifically in the nervous system, and the highest levels are found during development.
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20618448 This study presents further evidence of the contribution of GSK3beta to mood disorders, implicating a specific single nucleotide polymorphism and a haplotype with an earlier onset of the disorder
20618448 Observational study of gene-disease association. (HuGE Navigator)
20615469 Amyloid-beta peptide alteration of tau exon-10 splicing is related to its activation of GSK-3beta which in turn phosphorylates SC35.
20605420 results suggest GSK-3B polymorphism may play a role in genetic vulnerability to tardive dyskinesia manifestation in schizophrenia subjects with European Caucasians further implicating polymorphisms in dopamine D2-like receptor signaling in this context
20605420 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20599907 These results uncovered a novel mechanism for the GSK3beta negative regulation of TGF-beta1/Smad3 and Angiotensin II/ Smad3-mediated transcription and apoptosis by the identification of a crosstalk between GSK3beta and Smad3 signal pathway.
20561405 Meisoindigo can affect the Wnt signal pathway through inhibiting GSK-3beta expression and down-regulating beta-catenin and c-MYC protein expression, which play an important role in the treatment for chronic myeloid leukemia.
20541704 GSK-3 maintains the MLL leukemia stem cell transcriptional program by promoting the conditional association of CREB and its coactivators TORC and CBP with homedomain protein MEIS1, which in turn facilitates HOX-mediated transcription and transformation.
20531236 an X11alpha/fibrinogen silencer binding protein complex signals to the nucleus to repress glycogen synthase kinase-3beta promoter activity.
20525681 Data show that miR-26a directly interact with the 3'-untranslated repeat of the GSK-3beta mRNA and miR-26a-induced hypertrophy occurs via its target gene GSK-3beta.
20510151 GSK3b plays a crucial role in Alzheimer's disease. It has been implicated in multiple cellular processes & linked with the pathogenesis & neuronal loss in several neurodegenerative diseases, including Parkinson & Huntington diseases. Review.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20497256 found that Toll-like receptor 4 promoted apoptotic signalling by affecting the glycogen synthase kinase-3beta (GSK-3beta) pathway in a serum-deprivation-induced apoptotic paradigm.
20468064 Observational study of gene-disease association. (HuGE Navigator)
20457218 Overexpression of ss-arrestin 2 decreased the percentage of apoptosis and caspase-3 activation and attenuated resveratrol-reduced levels of p-Akt and p-GSK3ss.
20454507 GSK3beta modulates the cellular response to radiation in a beta-catenin-dependent mechanism
20453000 Observational study of gene-disease association. (HuGE Navigator)
20448354 The phosphorylation of GSK-3beta epithelial mesenchymal transition in human peritoneal mesothelial cells.
20399743 activation of Galphaq weakened the kinase activity of GSK-3beta and enhanced cellular accumulation of beta-Catenin.
20371704 Glycogen synthase kinase (GSK3) plays a central role in promoting glucocorticoid-induced apoptosis.
20368287 Data identify DEAF1 as an interactor and in vitro substrate of GSK3A and GSK3B that interacts with the phosphatidylinositol 3-kinase-mammalian target of rapamycin pathway.
20357815 cAMP/PKA pathway can suppress MMP-1 expression through inhibition of multiple signaling pathways, including MAPK and GSK-3beta
20352103 upon serum starvation, alpha(5)beta(1) integrin engagement could regulate specific pro-survival functions through the activation of GSK3beta
20351102 inhibiting GSK3 increases brain insulin-like growth factor I levels
20333643 Conclude that low-power laser irradiation protects against STS-induced apoptosis upstream of Bax translocation via the PI3K/Akt/GSK-3beta pathway.
20308328 Data show that PTPN11 mutations causing Leopard syndrome (LS) facilitate EGF-induced PI3K/AKT/GSK-3beta stimulation through impaired GAB1 dephosphorylation, resulting in deregulation of a novel signaling pathway that could be involved in LS pathology.
20226637 GSK3beta is a plausible candidate gene for bipolar disorder from a pharmacological and a genetic perspective--REVIEW
20219685 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20204404 GSK3B prevents in a differential fashion the malignant phenotype of HCT-116 colorectal cancer cells.
20190034 GSK-3beta phosphorylation is required and sufficient for pulmonary artery cellular hypertrophy.
20178594 GSK-3beta-related PMS2 downregulation has a role in the development of cervical carcinoma
20167573 Delayed re-endothelialization with rapamycin-coated stents is rescued by the addition of a glycogen synthase kinase-3beta inhibitor.
20160451 The GSK3 Activation Results in dentate gyrus degeneration.
20159967 GSK-3beta promotes cell survival by modulating Bif-1-dependent autophagic response and cell death.
20154711 The study data lead to the identification of glycogen synthase kinase 3 beta as a positive regulator of astrocytic differentiation in human malignant. glioblastoma cells.
20127713 The results suggest that GSK-3beta is an important element not only in AR stability but also significantly alters nuclear translocation of the AR, thereby modulating the androgenic response of human PCa cells.
20113358 Temporal lobe parenchymal grey matter volume in schizophrenia is associated with genetic variants of a promoter polymorphism associated with GSK3-beta activity.
20106550 Specific increases in the expression and phosphorylation of key regulatory kinases-- GSK-3 and Akt--are detectable in peripheral compartment of Parkinson disease patients.
20103767 GAS6 modulates macrophage cytokine secretion, triggering an "anti-inflammatory pathway" involving PI3K/Akt/GSK3 beta and NF-kappaB.
20080974 the N termini of both GSK-3 isoforms were dispensable, whereas progressive C-terminal deletions resulted in protein misfolding exhibited by deficient activity, impaired ability to interact with Axin, and a loss of Tyr(279/216) phosphorylation
20039940 Subjects carrying both heme oxygenase-1 (-413, rs2071746) TT genotype and GSK3beta (-157, rs6438552) TT genotype have a four times higher risk of developing Parkinson's diseae than subjects without these genotypes.
20039940 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20033742 The results suggested that the SNP rs6782799 in the GSK3B gene not only had a major effect on major depressive disorder , but also when combined with the BDNF locus, the risk could be further increased.
20033742 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20031160 ZM336372 inhibits GSK-3beta activity in pancreatic cancer cells.
20015462 This study suggested that two promoter polymorphisms of the GSK-3beta gene may not be related to the pathogenesis of major depression disorder and the risk of suicidal behavior in Korean depressive patients.
20015462 Observational study of gene-disease association. (HuGE Navigator)
20008284 evidence for a novel prerequisite priming mechanism for KIT-dependent responses regulated by GSK3beta in human mast cells.
20007971 Glycogen synthase kinase 3beta interaction protein functions as an A-kinase anchoring protein
19913121 Observational study of gene-disease association. (HuGE Navigator)
19903789 deregulated GSK3beta sustains gastrointestinal cancer cells survival through modulation of hTERT and telomerase
19882709 findings suggest that GSK-3beta is a differentiation fate determinant, and shed new lights on the mechanism by which GSK-3beta regulates cyclin D1 degradation and cellular differentiation in gliomas
19874574 Observational study of gene-disease association. (HuGE Navigator)
19841191 GSK3beta behaves as a proapoptotic regulator in DCs both in vitro and in vivo.
19833727 the PDX1 C terminus has a role in mediating the effects of glucose, which modulates PDX1 stability via the AKT-GSK3 axis
19823589 GSK3beta regulates differentiation and growth arrest in glioblastoma
19757160 The expression of beta-catenin protein in primary human thyrocytes was increased after GSK-3beta-targeting, the proliferation of primary human thyrocytes was significantly stimulated, while cell apoptosis was slightly affected.
19754670 Diabetic monocytes show increased migratory capacity in response to GSK-3beta inhibition.
19751508 aids in Wnt/beta-catenin signal transduction in invasive ductal carcinoma of breast
19727391 DHFR is a novel modulator of beta-catenin and GSK3 signaling
19717166 GSK-3beta may be a state rather than a trait marker for bipolar illness
19711366 PPP(S/T)P motif phosphorylation of the free LRP6 intracellular domain is not required to activate the Wnt/beta-catenin pathway and attenuate GSK3beta activity
19706605 GSK-3 interacts with and phosphorylates delta-catenin and thereby negatively affects its stability by enabling its ubiquitination/proteosome-mediated proteolysis
19692168 Observational study of gene-disease association. (HuGE Navigator)
19688630 GSK-3beta inhibitors 6BIO, 6BIOder, and 18BIOder have neuroprotective effects on Tat induced cell death in rat mixed hippocampal cultures
19682504 NDRG1 is not a classic client protein but interacts with Hsp90 and is still dually regulated by Hsp90 at a transcriptional and post-translational level. We suggest for the first time GSK3beta as a new client protein of Hsp90.
19681904 Pin1 overexpression in tamoxifen-resistant -MCF-7 cells is involved in the epithelial-mesenchymal transition process via PTEN-PI3-kinase-Akt-GSK-3beta and/or GSK-3beta-NF-kappaB-dependent Snail activation
19659461 calcineurin can dephosphorylate GSK-3beta at Ser-9 and form a stable complex with GSK-3beta, suggesting the possibility that calcineurin regulates the dephosphorylation and activation of GSK-3betain vivo
19657367 Single nucleotide polymorphism in glycogen synthase kinase 3 beta gene is associated with bone disease in myeloma.
19657367 Observational study of gene-disease association. (HuGE Navigator)
19656851 Studies show that GSK-3 and Omi/HtrA2 synergistically cause annexin A2 cleavage and then cell cycle inhibition or apoptosis.
19639192 GSK-3beta is involved in glandular structure formation and that the non-apical localization of membrane-localized GSK-3beta in tubular adenocarcinoma is associated with cancer development.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19607922 Results suggest that the alternatively spliced isoform of GSK-3beta, GSK-3beta2, is neuron-specific and has overlapping activities with GSK-3beta1.
19584164 Findings show that PI3K inhibition diminished hepatoblastoma cell growth being accompanied by reduced AKT and GSK-3beta phosphorylation.
19581563 The association between genotype and brain structure was specific to the patients with MDD, suggesting that GSK3beta genotypes might interact with MDD status.
19573950 The haplotype analysis of this study revealed that, the T-T haplotype of both GSK3beta polymorphisms was over-represented in parkinson disease patients compared to controls, and this association was independent of MAPT H1 haplotype.
19557001 Data show that REDD1 is subject to ubiquitin-mediated degradation mediated by the CUL4A-DDB1-ROC1-beta-TRCP E3 ligase complex and through the activity of glycogen synthase kinase 3beta.
19528467 Higher GSK3beta is associated with prostate cancer.
19505532 Data show that synthase kinase-3beta directly regulates both glycogen synthase activity in the absence of added insulin and through control of insulin action.
19501118 a functional role of GSK-3beta in amyloid-beta precursor protein processing, further implicating this kinase in the amyloid-beta-dependent pathogenesis
19477245 Review. It is proposed that GSK3 might be one of the factors regulating the onset of Alzheimer disease neurodegeneration following increased brain beta amyloid protein burden.
19472218 phospholipid transfer protein increases levels of the inactive form of glycogen synthase kinase-3beta (GSK3 beta)
19457211 the GSK-3beta C/C genotype with the BDNF val allele is associated with patients having schizophrenia without TD. the BDNF and GSK-3beta gene polymorphisms work in combination, but not individually, in predisposing patients with schizophrenia to TD.
19454488 Inhibition of endothelial progenitor cell glycogen synthase kinase-3beta results in attenuated neointima formation and enhanced re-endothelialization after arterial injury.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19429245 Cigarette smoke extract induces the activation of beta-catenin/TCF signaling through inhibiting GSK3beta.
19429119 Our data suggest that Leptin regulates tau phosphorylation through a pathway involving both AMPK and GSK-3beta.
19401395 In conclusion, our results suggest a significant role for GSK3 in guarding against mycobacterial evasion of immunity via IL-10 induction in the host.
19323791 immunoreactivity of IGF-I and GSK3a/b signaling pathways studied in ALS spinal cords and hippocampus with special reference to Kii and Guam ALS patients: in Japanese ALS patients, IGF-I expression was positively correlated with the clinical duration.
19321622 LANA does not regulate GSK-3beta kinase activity, and LANA-induced upregulation of beta-catenin is GSK-3beta independent.
19289791 GSK3beta phosphorylation modulates CLASP-microtubule association and lamella microtubule attachment.
19274078 Cadherin-11 mRNA and protein levels are regulated by the activity of GSK3beta and a significant degree of this regulation is exerted by the GSK3 target, beta-catenin, at the level of the cadherin-11 3'UTR
19265551 The N-terminal region of GSK3 beta binds p53, this association promotes the acetylation of p53, and subsequently acetylated p53 dissociates from GSK3.
19237556 Missplicing of GSK3beta represents a unique mechanism for the emergence of blast crisis chronic myeloid leukemia stem cells.
19190323 Galectin-3 mediates Wnt signaling acts by regulationg GSK3B phosphorylation and thus, the degradation of beta-catenin in colon cancer cells.
19188159 These results indicate that GSK3beta exerts a pathologic role by promoting the survival and proliferation of glioblastoma cells and by protecting them from apoptosis via the inactivation of p53- and/or Rb-mediated pathways.
19180470 CD16 cross-linking activated PI3K and that active PI3K limited TNF-alpha production by inhibiting GSK-3beta activity, that blocked the action of NF-kappaB.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19154537 Subjects carrying both the CDK5R1 (3'-UTR, rs735555) AA genotype and the GSK-3beta (-50, rs334558) CC genotype had a 12.5-fold decrease in Alzheimer disease risk suggesting synergistic effects (epistasis) between both genes
19154537 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19148484 GSK3B in involved in parathyroid carcinoma development, exploring possible therapeutic roots complementary to surgery.
19142874 Results describe a novel function of chaperonin 10 as a general differentiation factor, not limited to erythroid cells, and show how this biological effect is mediated by GSK-3alpha/beta.
19116273 ligation of ApoER2 by APC signals via Dab1 phosphorylation and subsequent activation of PI3K and Akt and inactivation of GSK3beta, thereby contributing to APC's beneficial effects on cells.
19107203 Phosphorylated LRP6/5 both recruits and directly inhibits GSK3beta using two distinct portions of its cytoplasmic sequence.
19104043 small molecule inhibitors of glycogen synthase kinase 3 (GSK-3) consistently caused a strong short period phenotype in contrast to the well-known period lengthening by lithium, another presumed GSK-3 inhibitor.
19060929 the AURKA/GSK-3beta interaction is important in regulating beta-catenin
19050253 GSK3beta regulates the magnitude of IL-10 production by memory CD4-positive T cells; repression of GSK3beta activity enhances the productivity and frequency of IL-10-producing memory CD4+ T cells.
19022564 glycogen synthase kinase 3beta protein is expressed in normal colon epithelium and aberrantly distributed in colorectal cancer
19007860 Our results suggest that GSK-3beta plays a role in the pathogenesis of Parkinson Disease but not in that of Multiple System Atrophy.
19003984 Results indicate that the introduction of pSer to WT GSK3beta generates a slight lobe closure on GSK3beta without any remarkable changes.
18996844 VacA activates the PI3K/Akt signaling pathway, resulting in phosphorylation and inhibition of GSK3beta, and subsequent translocation ofbeta-catenin to the nucleus, consistent with effects of VacA on beta-catenin-regulated transcriptional activity.
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18991351 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18973553 GSK-3beta inhibitors 6BIO, 6BIOder, and 18BIOder have neuroprotective effects on Tat induced cell death in rat mixed hippocampal cultures
18955053 This review concentrates on the role of protein kinase glycogen synthase kinase 3 in the different types of Alzheimers' disease.
18955029 Lys85 is important to GSK-3beta activity; the mutation of this residue could inhibit the activity of GSK-3beta.
18952601 Novel regulation of vascular endothelial growth factor-A (VEGF-A) by transforming growth factor (beta)1: requirement for Smads, (beta)-CATENIN, AND GSK3(beta).
18855532 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18852354 To our knowledge, this is the first evidence that a gene known to be involved in tau phosphorylation, GSK3B, is associated with risk for primary neurodegenerative dementias.
18852354 Observational study of gene-disease association. (HuGE Navigator)
18852124 The fat-1 gene expression inhibited prostate cancer cell proliferation via reduction of GSK-3beta phosphorylation and subsequent down-regulation of both beta-catenin and cyclin D1.
18838540 Results describe a convergence point of the GSK-3beta and the glucocorticoid receptor pathways, and suggest a mechanism by which GSK-3beta activity can dictate how cells will ultimately respond to glucocorticoids.
18829575 GSK-3 and IKK as potential therapeutic targets for pancreatic cancer.
18826950 GSK-3beta inhibitors 6BIO, 6BIOder, and 18BIOder have neuroprotective effects on Tat induced cell death in rat mixed hippocampal cultures
18806775 pharmacological, physiological and genetic studies that demonstrate an oncogenic requirement for GSK3 in the maintenance of a specific subtype of poor prognosis human leukaemia, genetically defined by mutations of the MLL proto-oncogene
18804163 Glycogen synthase kinase 3 beta is phosphorylated and inhibited by Thrombopoietin-induced Proto-Oncogene Proteins c-akt, promoting survival and proliferation in megakaryocytic cells through a pathway that does not involve beta-catenin
18801732 Reduced CREB phosphorylation (Ser-129) associated with inactivation of GSK3beta by Ser-9 phosphorylation may be the major mechanism underlying PEPCK-C gene suppression by AMPK-activating agents such as biguanide
18787224 33 (52%) of 64 mantle cell lymphoma tumors showed nuclear localization of beta-catenin, which significantly correlated with the expression of the phosphorylated/inactive form of GSK3beta
18786229 GSK3B is a novel marker and modulator of inflammatory injury in chronic renal allograft disease.
18782353 As the downstream of Akt activation, H. pylori infection inactivated the inactivation of glycogen synthase kinase 3beta at Ser 9 by its phosphorylation.
18769147 Inhibition of PI3-K/Akt induces a 40% decrease of cyclin D1 half-life as a result of accumulation of the dephosphorylated/active form of GSK-3beta within the nucleus, where it can phosphorylate cyclin D1 on Thr286 thereby promoting its nuclear export.
18768676 Polymorphisms in two components of the insulin signaling pathway, AKT2 and GSK3B, are associated with polycystic ovary syndrome.
18768676 Observational study of gene-disease association. (HuGE Navigator)
18708403 Observational study of gene-disease association. (HuGE Navigator)
18689794 Tissue kallikrein decreased GSK-3beta activity via the phosphatidylinositol 3-kinase-Akt pathway and enhanced VEGF and VEGFR-2 expression in endothelial cells.
18687691 isoflavone-induced inhibition of cell proliferation and induction of apoptosis are partly mediated through the regulation of the Akt/FOXO3a/GSK-3beta/AR signaling network.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18632640 GSK-3beta signaling is a key regulator of radiation-induced damage in hippocampal neurons
18628988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18615589 inhibition of GSK-3beta by lithium chloride elicited a stimulatory effect on DeltaNp63 promoter activity
18606491 review of the roles of GSK3beta in tumorigenesis and cancer chemotherapy [review]
18602000 These results demonstrated that GSK3beta is implicated in the regulation of melanogenesis.
18588978 We conclude that the phosphorylation of tau by GSK-3beta either prior to or following polymerization promotes polymer/polymer interactions that result in stable clusters of tau filaments.
18552505 findings suggest that hepatitis B virus X protein (HBx) negatively regulated proliferation of CCL13-HBx-stable cells via the GSK-3beta/beta-catenin cascade
18500637 Our results suggest that GSK3beta polymorphisms might be involved in schizophrenia risk
18451303 p38 mitogen-activated protein kinase (MAPK) also inactivates GSK3beta by direct phosphorylation at its C terminus, and this inactivation can lead to an accumulation of beta-catenin
18450971 Activin A may mediate ovarian oncogenesis by activating Akt and repressing GSK to stimulate cellular proliferation.
18437054 tetrandrine induces G(1) arrest and apoptosis through PI3K/kip1/AKT/GSK3beta pathway
18408738 Results suggest that GSK-3 regulates nuclear p27 Kip1 expression through downregulation of Skp2 expression and regulates p27 Kip1 assembly with CDK2, playing a critical role in the G0/G1 arrest associated with intestinal cell differentiation.
18391982 the functional regulation of p53 by triptolide was mediated by an intranuclear association of p53 with glycogen synthase kinase-3beta (GSK3beta), which was inactivated by protein kinase C (PKC).
18391981 GSK-3beta modulates the early mitotic Aurora-A level through binding and phosphorylating AIP.
18316598 GSK3 beta is a bona fide PRLr kinase that phosphorylates PRLr on Ser(349) and is required for the recognition of PRLr by beta Trcp, as well as for PRLr ubiquitination and degradation
18316369 GSK-3beta regulates the localization of gamma-tubulin ring complex, including GCP5, to the spindle poles, thereby controlling the formation of proper mitotic spindles
18263590 The formation of an ERK.GSK3beta complex retained pERK1/2 in the cytoplasm.
18252708 that inhibition of the GSK-3beta/eIF2Bepsilon translational control pathway contributes to airway smooth muscle hypertrophy in vitro and in vivo.
18243662 Ionizing radiation-induced GSK-3beta phosphorylation could contribute to the transcriptional transactivation of NF-kappaB in an ATM-independent manner.
18223684 GSK-3beta enters the nucleus, forms a complex with beta-catenin and lowers the levels of beta-catenin/TCF-dependent transcription in a mechanism that involves GSK-3beta-Axin binding
18221734 GSK3beta expression is upregulated in frontal and temporal cortex in ALS with cognitive impairment.
18219478 When transfected into mice, beta cells have reduced mass and proliferation.
18218855 GSK3beta acts as a negative regulator of platelet function in vitro and in vivo.
18201972 phosphorylation of Ser-468 was indispensable for the physical interaction between RelA/p65 and GSK3beta.
18195729 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18178198 Abnormal GSK3beta regulation is a potential mechanism for the insulin resistance that is seen in some women with polycystic ovary syndrome.
18167338 Glycogen synthase kinase-3beta (GSK-3beta) phosphorylates Cdc25A to promote its proteolysis in early cell-cycle phases.
18156211 sFRP-1 can interact with Wnt receptors Frizzled 4 and 7 on endothelial cells to transduce downstream to cellular machineries requiring Rac-1 activity in cooperation with GSK-3beta
18083346 HSP105 appears to chaperone the responses to endoplasmic reticulum (ER) stress through its interactions with GRP78 and GSK3, and without HSP105 cell death following ER stress proceeds by a non-caspase-3-dependent process.
18055457 GSK3beta interacts with and phosphorylates the spindle-associated protein Astrin, resulting in targeting Astrin to the spindle microtubules and kinetochores.
17991738 GSK3B protects melanoma cells from the apoptotic effects sorafenib, providing a survival signal that minimizes cellular injury.
17990294 cAMP/PKA signaling activates the canonical Wnt pathway through the inactivation of GSK-3beta, whereas Wnt signaling might inhibit bone resorption through a negative impact on RANKL expression in osteoblasts.
17976739 Association between GSJ-3beta-50T/C polymorphism and personality and psychotic symptoms in mood disorders.
17976739 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17972518 Phosphorylated-GSK3beta-ser9 and EGFR are involved in the histogenesis of different lung carcinomas.
17951252 modulation of phosphatidylinositol 3-kinase/Akt/GSK3beta signaling cascades can be beneficial for protecting or facilitating recovery from cellular LeTx intoxication in cells that depend on basal MEK1 activity for proliferation.
17912008 glycogen synthase kinase-3beta (GSK-3beta) was found to regulate NF kappa B activation and the proliferation and survival of pancreatic cancer cells.[review]
17908237 This indicates that if the majority of tau is phosphorylated at S396/S404, in combination with increased GSK3beta activity, tau aggregation is favored. T
17717075 GnRH treatment mediates the inactivation of glycogen synthase kinase-3, a protein serine/threonine kinase that regulates beta-catenin degradation within the Wnt signaling pathway
17711861 a direct link between GSK-3beta and MLK3 activation in a neuronal cell death pathway and identify MLK3 as a direct downstream target of GSK-3beta.
17697341 observations indicate a role for GSK-3 in accurate chromosome segregation
17681942 analysis of phosphorylation and regulation of human CTPS1 in human cells shows that GSK3 is a novel regulator of CTPS activity
17671694 pGSK-3beta-ser-9 may confer the cisplatin resistance of ovarian carcinomas through the stabilization of p53 expression
17628506 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17621269 Ajuba promoted GSK-3beta-mediated phosphorylation of beta-catenin by reinforcing the association between beta-catenin and GSK-3beta.
17621172 Single nucleotide polymorphisms are not asociated with bipolar disorder.
17609434 GSK-3 is required for E2-induced ERalpha phosphorylation at Ser-118 and full transcriptional activity of the receptor upon E2 stimulation.
17590240 We demonstrated that treatment with EGCG reduced the A beta levels by enhancing endogenous APP nonamyloidogenic proteolytic processing.
17565981 GSK3beta facilitates the association of T4 and T4C3, and the presence of caspase-cleaved tau is necessary for the evolution of tau oligomers into Sarkosyl-insoluble inclusions even though it is not extensively phosphorylated
17562708 phosphorylation sites in tau from Alzheimer brain show that casein kinase 1delta may have a role, together with glycogen synthase kinase-3beta, in the pathogenesis of Alzheimer disea
17522055 3,3'-diindolylmethane -induced cell growth inhibition and apoptosis induction are partly mediated through the regulation of Akt/FOXO3a/GSK-3beta/beta-catenin/AR signaling
17486076 cyclin D2 expression in normal and malignant hematopoietic cells is regulated by ubiquitin/proteasome-dependent degradation triggered by Thr280 phosphorylation by GSK3beta or p38, which is induced by inhibition of the PI3K pathway
17483602 GSK-3beta was dephosphosphorylated at Ser9 & its enzymatic activity increased in palmitate-treated human umbilical vein endothelial cells. GSK-3beta inhibitors & transduction with a catalytically inactive GSK-3beta protected the cells from apoptosis.
17475833 Unrestrained glycogen synthase kinase 3 beta is responsible for growth factor withdrawal induced activated T cell death.
17438332 antiapoptotic effect of GSK3beta in tumor necrosis factor-induced apoptosis is mediated by cytosolic, not nuclear, GSK3beta
17437044 GSK3beta may induce G(1) cell cycle arrest in a cyclin D1-dependent fashion and therefore possibly play a growth-inhibitory role in A549 cells.
17437043 APC protein and GSK3beta may synergistically play an important role in the repair of airway epithelial cells.
17434145 Our results imply that phosphorylation of serine 256 in ataxin-3 by GSK 3beta regulates ataxin-3 aggregation.
17389597 abnormal activation of glycogen synthase kinase 3beta can reduce neuronal viability and synaptic plasticity via modulating Presenilin 1/N-cadherin/beta-catenin interaction and thus have important implications in the pathophysiology of Alzheimer disease.
17387146 Results indicate that the turnover of Mcl-1 by beta-TrCP is an essential mechanism for GSK-3beta-induced apoptosis and contributes to GSK-3beta-mediated tumor suppression and chemosensitization.
17368486 Our results fail to replicate the association of the GSK-3 beta gene with susceptibility to schizophrenia in the Chinese population.
17368486 Observational study of gene-disease association. (HuGE Navigator)
17357145 Observational study of gene-disease association. (HuGE Navigator)
17357145 GSK3beta may be involved in Bipolar Disorder susceptibility in some individuals.
17325032 direct regulation of hypoxia-inducible factor 1 alpha subunit stability by GSK-3 may influence physiological processes or pathophysiological situations such as metabolic diseases or tumors
17283049 This is the first demonstration of GSK-3beta as the missing link between UV-induced ATR activation and p21 degradation.
17273789 IL-6, via the PI3-kinase/Akt pathway leads to inhibition of the repressive kinases MAPK/pERK and GSK3beta, and this converts inactive HSF-1 to an intermediate DNA-binding form augmenting transcriptional activation in the presence of a second stressor.
17270183 Observational study of gene-disease association. (HuGE Navigator)
17241872 GSK3beta-dependent protein degradation was switched between Hath1 and beta-catenin by Wnt signaling, leading to the dramatic alteration of cell status between proliferation and differentiation in colon cancer
17233643 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17160944 Observational study of gene-disease association. (HuGE Navigator)
17159916 Of special interest was the rapid decrease in expression of MITF in melanocytes treated with DKK1, which is concurrent with the decreased activities of beta-catenin and of glucose-synthase kinase 3beta
17150190 We conclude that hCSCs exhibit mesenchymal features and that Akt/GSK-3beta may be crucial modulators for hCSC maintenance in human heart.
17139249 These results imply that GSK-3beta may function in transporting centrosomal proteins to the centrosome by stabilizing the BICD1 and dynein complex, resulting in the regulation of a focused microtubule organization.
17107957 R-Ras and ILK have roles upstream of GSK-3beta in the regulation of neuronal polarity
17098228 The current data suggest that, following exposure to zinc, the sequential activation of Akt and GSK-3beta plays an important role directing hippocampal neural precursor cell death.
17072303 The identification of a beta-catenin-T-cell factor-regulated Axin2-GSK3beta-Snail1 axis provides new mechanistic insights into cancer-associated epithelial-mesenchymal transition programmes.
17052453 S6K1 regulates GSK3 under conditions of mTOR-dependent feedback inhibition of Akt
17050006 offer a new mechanism of regulation of E2F transcription factor 1 by direct binding of GSK3beta to its transactivation domain
17046823 GSK-3beta but also DYRK1B modulates cyclin D1 subcellular localization by the phosphorylation of Thr(288). These results suggest that DIF-3 induces degradation of cyclin D1 through the GSK-3beta- and DYRK1B-mediated threonine phosphorylation in HeLa cells
17028556 GSK-3B is the missing link between the amyloid and tau-pathology, and position GSK-3B as prominent player in the pathogenesis in Alheimer disease.
17016438 Hypersensitivity of medulloblastoma cells in anchorage-independence is linked to GSK-3beta activity.
16987514 These results indicate that the protein phosphatase-1/inhibitor-2 complex differentially regulates GSK3 dephosphorylation induced by KCl and that GSK3 activity regulates SERCA2 levels.
16987250 This study fails to support reduced signaling of the AKT-GSK3beta molecular cascade in schizophrenia.
16984735 NT uses PKC-dependent pathways to modulate GSK-3, which may play a role in the NT regulation of intestinal cell growth
16982692 this study provides, for the first time, insights into the involvement of MRP2 in neurite outgrowth, which occurs in a GSK3beta-dependent manner.
16981698 GSKIP is a naturally occurring protein that is homologous with the GSK3beta interaction domain of Axin and is able to negatively regulate GSK3beta of the Wnt signaling pathway.
16951223 The GSK-3beta nuclear accumulation as a hallmark of poorly differentiated pancreatic adenocarcinoma, and provide new insight into the mechanism by which GSK-3beta regulates NF-kappaB activity in pancreatic cancer.
16942622 GSK3 activity has little influence over cyclin D1 expression levels during any cell cycle phase.
16934436 These results suggest i) an essential role of PI3K/Akt/GSK-3alpha/beta signaling for a successful replication of VZV and ii) a key function of VZV kinases pORFs 47 and 66 to activate this pathway.
16916907 We demonstrate, for the first time in human skeletal muscle, that the regulation of Akt and its downstream signalling pathways GSK-3beta, mTOR and Foxo1 are associated with both the skeletal muscle hypertrophy and atrophy processes.
16912034 analysis of critical variations in the function and regulation of GSK-3alpha and GSK-3beta
16893889 substrate recognition involves interactions with GSK-3beta residues: Phe67, Gln89, and Asn95, which confer a common basis for substrate binding and selectivity, yet allow for substrate diversity
16882987 Cyclic expression of GSK-3beta's active and inactive forms in the endometrium suggests that sex hormones regulate its expression. In vitro experiments demonstrate that progesterone induces phosphorylation of endometrial GSK-3beta.
16861141 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16788573 Results suggest that glycogen synthase kinase-3beta activity is important for the proliferation of ovarian cancer cells, implicating this kinase as a potential therapeutic target in ovarian cancer.
16787706 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16767496 Hypertonic conditions induced with NaCl and other osmolytes were used to stimulate several tumor cell lines, Glycogen Synthase Kinase 3beta (GSK3beta) was rapidly dephosphorylated at serine 9 and its kinase activity was increased.
16757548 there is tissue specificity for the regulation of GSK-3 in humans; in skeletal muscle GSK-3 plays a role in control of metabolism and insulin action, whereas the function in adipose tissue is less clear
16705181 Multisite glycogen synthase kinase 3beta (GSK3beta) phosphorylation and ubiquitination by SCFbetaTrCP are required for Gli3 processing.
16645641 findings show an increase in the immunoreactivities for the nuclear C-terminal fragments of APLP2 and for GSK-3beta in the brains of Alzheimer disease patients
16611631 GSK3 alters phosphorylation of CRMP-1, -2, and -4 isoforms
16601113 GSK-3beta selectively regulates NFkappaB-mediated inflammatory gene expression of IL-1beta and TNF-alpha by controlling the flow of NFkappaB activity between transcription of inflammatory and survival genes
16571670 protection of beta-catenin from ubiquitination and proteasomal degradation induced by glycogen synthase kinase (GSK)-3beta inhibition
16551619 GSK3beta inhibits the xenobiotic and antioxidant cell response by direct phosphorylation and nuclear exclusion of the transcription factor Nrf2
16543145 The results demonstrate that the control of MCL-1 stability by GSK-3 is an important mechanism for the regulation of apoptosis by growth factors, PI3K, and AKT.
16528748 Observational study of gene-disease association. (HuGE Navigator)
16462886 Cytokine-dependent GSK-3 phosphorylation in hemopoietic cells proceeds primarily through Protein Kinase B independent pathways.
16428884 Observational study of gene-disease association. (HuGE Navigator)
16428445 GSK-3 and h-prune cooperatively regulate the disassembly of focal adhesions to promote cell migration and that h-prune is useful as a marker for tumor aggressiveness.
16421604 GSK3beta is not only a critical regulator of proproliferative signalling but also a promiscuous one as PI3K/Akt pools of GSK3beta are, at least in part, functionally interchangeable with those of the Wnt/beta-catenin pathway
16420965 Our results demonstrate that the flow cytometry-based method is a convenient tool to analyze the effect of GSK-3beta inhibitors on Tau phosphorylation. This
16397405 Observational study of gene-disease association. (HuGE Navigator)
16397405 A trend was found towards an association for the C allele in the whole group of schizophrenic patients and for the heterozygous T/C genotype of bipolar patients.
16371352 inhibition of GSK-3beta stimulates COX-2 expression in gastric cancer cells
16365045 a direct interaction between LRP6 and GSK3 results in an attenuation of GSK3 activity
16341242 GSK-3 is a specific in vivo modulator of hematopoietic stem cell activity
16315267 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16315267 GSK3B polymorphisms alter transcription and splicing and interact with Tau haplotypes to modify disease risk in Parkinson disease
16289845 Observational study of gene-disease association. (HuGE Navigator)
16278684 GSK-3, acting through PKCdelta, is a negative regulator of ERK1/2
16257959 GSK-3beta directly phosphorylates and activates MARK2/PAR-1
16210249 These results identify glycogen synthase kinase 3beta and FBW7 as potential cancer therapeutic targets and MYC as a critical substrate in the GSK3beta survival-signaling pathway.
16198352 findings suggest the ERK/MAPK and PI3K pathways may regulate VEGF expression in part through regulating the action of these repressor proteins
16174773 GSK3beta modulates synphilin-1 ubiquitylation and cellular inclusion formation by SIAH
16107342 multiple kinases, including CK2 and GSK3beta, participate in PTEN phosphorylation and GSK3beta may provide feedback regulation of PTEN
16076840 GSK-3 interacts with and phosphorylates ESRalpha and is involved in the regulation of receptor activity
16055726 GSK3-dependent phosphorylation of Mdm2 regulates p53 abundance
16043125 Our findings demonstrate an unrecognized role of GSK3beta in tumor cell survival and proliferation other than its predicted role as a tumor suppressor.
16007092 GSK3 has a role in modulating the inflammatory response and toll-like receptor-mediated cytokine production
15993040 These findings suggest that glycogen synthase kinase-3beta is involved in hydrogen peroxide-mediated inhibition of Tcf/Lef-dependent transcriptional activity.
15981102 No significant genetic alterations were found.
15963640 These data indicate that 14-3-3zeta may not be directly interacting with GSK3beta and tau in the brain, but may indirectly facilitate the interactions by binding to other proteins.
15942663 GSK-3beta reactivation is involved in the process through which LY294002 sensitizes hepatoma cells to chemotherapy-induced apoptosis via death receptor and mitochondria signalling pathways
15940626 a unique cooperative interaction possible between 2 critical oncogenic pathways in colorectal tumorigenesis, and pivotal role of GSK-3beta suggested
15799972 KCl-induced depolarization causes undulating GSK-3beta phosphorylation/dephosphorylation, which is regulated for the most part by phosphatidylinositol 3-kinase and Akt (phosphorylation) and PP2A and PP2B (dephosphorylation), respectively
15752768 In kinase assay, we also showed that CABYR variants act as an ideal substrate for GSK3beta within the extensin-like domain and phosphorylation sites on CABYR were mapped.
15719395 Observational study of gene-disease association. (HuGE Navigator)
15719395 Results indicate that GSK3B may not play a major role in Japanese schizophrenia.
15631989 Data show that the activity of glycogen synthase kinase-3 (GSK-3) is necessary for the maintenance of the epithelial architecture, and that GSK-3 inhibition stimulates the transcription of Snail.
15609321 GSK3 and PKB/Akt have roles in the integrin-mediated regulation of PTHrP, IL-6 and IL-8 in pancreatic cancer
15555766 Total GSK-3 protein was increased in both Alzheimer's disease and in mild cognitive impairment without a compensatory decrease in activity
15522877 FRAT-2 enhances GSK3 beta-mediated phosphorylation of a primed substrate to a greater extent than an unprimed substrate
15517997 In transgenic mice, GSK3betaS9A resulted in hyperphosphorylation of tau and morphology reminiscent of pretangle-like neurons in cortex and hippocampus.
15456937 Results propose a new mechanism by which lithium indirectly inhibits glycogen synthase kinase-3beta via phosphatidylinositol 3 kinase-dependent activation of protein kinase C alpha.
15379854 A portion of the p53 that is activated in senescent cells is modulated by its association with GSK3beta in the nucleus.
15375789 overexpression of human GSK-3beta in skeletal muscle of male mice resulted in impaired glucose tolerance despite raised insulin levels
15351432 Observational study of gene-disease association. (HuGE Navigator)
15351432 A glycogen synthase kinase 3-beta promoter gene single nucleotide polymorphism is associated with age at onset and response to total sleep deprivation in bipolar depression.
15254796 the reduction in brain GSK-3beta is reflected in CSF of schizophrenia patients
15252116 GSK-3beta has a role in cAMP-induced degradation of cyclin D3
15179015 Observational study of gene-disease association. (HuGE Navigator)
15178691 GSK3 beta may function as a repressor to suppress AR-mediated transactivation and cell growth
15132987 6-OHDA inhibited phosphorylation of GSK3beta at Ser9, & induced hyperphosphorylation of Tyr216 with little effect on expression. GSK3beta is a critical intermediate in pro-apoptotic signaling cascades that are associated with neurodegenerative diseases.
15073173 GSK3beta is connected to tau by 14-3-3 and Ser(9)-phosphorylated GSK3beta phosphorylates tau
15026145 These results suggest that short-term exposure to TNF-alpha augments insulin effects through protein kinase B-alpha and glycogen synthase kinase-3 beta, whereas long-term exposure causes insulin resistance in HepG2 cells.
15020233 Glycogen synthase kinase-3beta is tyrosine-phosphorylated by mitogen-activated protein kinase kinase 1 in fibroblasts.
14991743 APC/GSK-3beta, through beta-catenin, may crossregulate NF-kappaB signaling pathway
14988390 Most importantly, knocking down GSK-3beta expression via a small interference RNA-mediated gene silencing approach also reduced R1881-stimulated gene expression, demonstrating the specificity of GSK-3beta involvement.
14988008 Clozapine appears to regulate the phosphorylation of GSK3B through Wnt signal pathways involving Dvl upstream but not through the P13K-Akt pathway in human neuroblastoma cells.
14985354 glycogen synthase kinase-3 beta phosphorylates the androgen receptor, thereby inhibiting androgen receptor-driven transcription
14744935 ER stress induces GSK-3beta binding to p53 in the nucleus and enhances the cytoplasmic localization of the tumor suppressor.
14729229 Observational study of gene-disease association. (HuGE Navigator)
14729229 No association was detected between GSK3-beta -50 T/C SNP and the presence of bipolar illness. Homozygotes for the wild variant (T/T) showed an earlier age at onset than carriers of the mutant allele (F=5.53, d.f.=2,182, P=0.0047).
14729058 GSK3B regulates the cytoskeleton and translocation of Rac1 in keratinocyte lamellipodia.
14691449 CF101 inhibits human colon carcinoma growth in mice via modulation of GSK3B.
14660640 TSH/cAMP-stimulated p70S6 kinase activity and cell proliferation is regulated by Rap1GAP in thyroid cells
14617795 a mechanism involving GSK-3beta activation may be responsible for tumor necrosis factor-related apoptosis-inducing ligand resistance in prostate cancer cells
14561750 activation of Csk and GSK-3beta by Galphaq may contribute to the physiological and pathological effects of Gq-coupled receptors
14550568 GSK3beta is a potential regulator of platelet function
14536078 multisite phosphorylation by Cdk2 and GSK3 controls cyclin E degradation
14523002 role in binding to and promoting action of p53
14520463 Increased expression of glycogen synthase kinase 3 is associated with ovarian epithelial cell transformation and in tumour progression
14518171 possible role of GSK-3 beta, a pro-apoptotic factor participating in signal transduction involved in cell survival, is discussed in relation to schizophrenia
12969793 Overexpression of phospho-GSK-3beta is associated with hepatocellular carcinoma
12900420 glycogen synthase kinase-3beta is suppressed by Akt in prostate cancer cells which leads to the phosphorylation of cAMP-response element-binding protein
12871932 molecular cross-talk between glycogen synthase kinase-3 beta (GSK-3 beta) and the p105 precursor of the NF-kappa B p50 subunit
12829841 manipulation of GSK-3beta activity may be a mechanism by which HHV-8 latency-associated nuclear antigen (LANA) may modify transcriptional activity and contribute to the phenotype of HHV-8 primary effusion lymphoma.
12796505 GSK-3 regulates its own phosphorylation status
12778079 Cell adhesion to the extracellular matrix protein fibronectin modulates radiation-dependent G2 phase arrest and involve this enzyme in vitro.
12761178 first demonstration that glycogen synthase kinase-3beta associates with type 1 protein phosphatase/inhibitor-2 (PP1C/I-2) complex and phosphorylates I-2 at T72 in intact cells
12663502 role in mouse hepatic carcinogenesis
12603528 Messenger RNA of beta-catenin and Tcf-4, but not GSK-3beta, was found to be overexpressed in HCC(hepatocellular carcinoma).
12584189 GSK3 beta functions as a natural activator of MEKK1
12566926 plays a role in Alzheimer disease and other CNS disorders (REVIEW)
12554650 Data report the crystal structure of glycogen synthase kinase 3beta (GSK3beta) in complex with a minimal GSK3beta-binding segment of axin, at 2.4 A resolution.
12387894 role in phosphorylating tau protein
12379450 Fresh lymphocytes from schizophrenic patients showed no difference in GSK-3 alpha and GSK-3beta mRNA levels, GSK-3beta protein levels, or total GSK-3 (alpha+beta) enzyme activity compared with findings in control subjects.
12376533 GSK3b expresion is regulated by reelin
12364325 inhibition of GSK3beta activity appears to trigger nuclear accumulation of cyclin D1 and cell cycle progression
12244165 GSK-3 beta is inhibited by endothelial cell costimulation, allowing nuclear accumulation of NFAT and prolonging IL-2 synthesis in the presence of cyclosporin A.
12228224 Data show that endoplasmic reticulum stress induced by thapsigargin not only activated the apoptosis effector caspase-3 but also caused a large and prolonged increase in the activity of glycogen synthase kinase-3beta.
12182887 Glycogen synthase kinase 3 beta influenced post-natal maturation and differentiation of neurons in vivo in transgenic mice that overexpress a constitutively active GSK-3beta.
12167628 GSK3beta functions at the nodal point of converging signaling pathways in endothelial cells to regulate vessel growth through its control of vascular cell migration and survival.
12147701 A-kinase anchoring protein AKAP220 binds to this enzyme and mediates protein kinase A-dependent inhibition of GSK-3beta
12130654 GSK3b binds to and phosphorylates serine493 in glutamate E segment of NEFH
12086949 improves insulin action and glucose metabolism in skeletal muscle
12054501 Human serum and glucocorticoid-inducible kinase-like kinase (SGKL) phosphorylates glycogen syntheses kinase 3 beta (GSK-3beta) at serine-9 through direct interaction
12048243 reacts with p53 protein after dna damage
11986994 signaling systems determining cell fate appear to be important targets of mood stabilizers, and these may include signaling pathways encompassing GSK3beta, including transcription factors regulated by GSK3beta(REVIEW)
11967263 Arg(96) mutant has a dominant-negative effect on GSK-3beta-dependent phosphorylation of beta-catenin and targeting of beta-catenin for degradation requires prior priming through phosphorylation of Ser(45)
11903055 Protein kinase A enhances, whereas glycogen synthase kinase-3 beta inhibits, the activity of the exon 2-encoded transactivator domain of heterogeneous nuclear ribonucleoprotein D in a hierarchical fashion.
11495916 The intracellular distribution of GSK-3 beta is dynamically regulated by signaling cascades, and apoptotic stimuli cause increased nuclear levels of GSK-3 beta, which facilitates interactions with nuclear substrates.
10428053 GSK-3beta inhibitors 6BIO, 6BIOder, and 18BIOder have neuroprotective effects on Tat induced cell death in rat mixed hippocampal cultures

AA Sequence

MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVV      1 - 70
YQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVY     71 - 140
RVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRG    141 - 210
EPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ    211 - 280
IREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKL    281 - 350
PNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST    351 - 420
//

Text Mined References (889)

PMID Year Title
26850078 2016 Exposure to a 50-Hz magnetic field induced mitochondrial permeability transition through the ROS/GSK-3? signaling pathway.
26845447 2016 Downregulation of tumor suppressing STF cDNA 3 promotes epithelial-mesenchymal transition and tumor metastasis of osteosarcoma by the Wnt/GSK-3?/?-catenin/Snail signaling pathway.
26826001 2016 Hepatic IGF-1R overexpression combined with the activation of GSK-3? and FOXO3a in the development of liver cirrhosis.
26822034 2016 Inactivation of nuclear GSK3? by Ser(389) phosphorylation promotes lymphocyte fitness during DNA double-strand break response.
26766591 2016 GSK3 Deficiencies in Hematopoietic Stem Cells Initiate Pre-neoplastic State that Is Predictive of Clinical Outcomes of Human Acute Leukemia.
26711256 2015 Glycogen Synthase Kinase 3? Is Positively Regulated by Protein Kinase C?-Mediated Phosphorylation Induced by Wnt Agonists.
26707164 2016 AMPK interacts with ?-catenin in the regulation of hepatocellular carcinoma cell proliferation and survival with selenium treatment.
26707073 2016 CD151 knockdown inhibits osteosarcoma metastasis through the GSK-3?/?-catenin/MMP9 pathway.
26631736 2016 Mesenchymal Stem Cells From Infants Born to Obese Mothers Exhibit Greater Potential for Adipogenesis: The Healthy Start BabyBUMP Project.
26618897 2015 Lithium Chloride Dependent Glycogen Synthase Kinase 3 Inactivation Links Oxidative DNA Damage, Hypertrophy and Senescence in Human Articular Chondrocytes and Reproduces Chondrocyte Phenotype of Obese Osteoarthritis Patients.
26560046 2015 GSK3? mediates the carcinogenic effect of HPV16 in cervical cancer.
26546129 2016 Beyond the brain: disrupted in schizophrenia 1 regulates pancreatic ?-cell function via glycogen synthase kinase-3?.
26530498 2016 TIPE2 functions as a metastasis suppressor via negatively regulating ?-catenin through activating GSK3? in gastric cancer.
26499802 2015 Endoplasmic Reticulum (ER) Stress Induces Sirtuin 1 (SIRT1) Expression via the PI3K-Akt-GSK3? Signaling Pathway and Promotes Hepatocellular Injury.
26496802 2015 Inhibition of DYRK1A and GSK3B induces human ?-cell proliferation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26440826 2016 GSK-3? controls autophagy by modulating LKB1-AMPK pathway in prostate cancer cells.
26431581 2015 Critical link between glycogen synthase kinase 3? and forkhead box P3 in patients with chronic rhinosinusitis with nasal polyps.
26398368 2015 Toosendanin inhibits growth and induces apoptosis in colorectal cancer cells through suppression of AKT/GSK-3?/?-catenin pathway.
26388612 2015 GSK-3? regulates tumor growth and angiogenesis in human glioma cells.
26372541 2015 Trace amine-associated receptor 1 activation silences GSK3? signaling of TAAR1 and D2R heteromers.
26359353 2015 NDRG1 promotes growth of hepatocellular carcinoma cells by directly interacting with GSK-3? and Nur77 to prevent ?-catenin degradation.
26320152 2015 Glycogen synthase kinase-3? modulation of glucocorticoid responsiveness in COPD.
26311646 2015 BDNF promotes the growth of human neurons through crosstalk with the Wnt/?-catenin signaling pathway via GSK-3?.
26311045 2015 Human placental extract exerts hair growth-promoting effects through the GSK-3? signaling pathway in human dermal papilla cells.
26284974 2015 Idebenone protects against oxidized low density lipoprotein induced mitochondrial dysfunction in vascular endothelial cells via GSK3?/?-catenin signalling pathways.
26281299 2015 [Association between GSK3? polymorphisms and the smoking habits in young Japanese].
26274564 2015 FAK/PYK2 promotes the Wnt/?-catenin pathway and intestinal tumorigenesis by phosphorylating GSK3?.
26240334 2015 FXR1P is a GSK3? substrate regulating mood and emotion processing.
26240274 2015 Glycogen Synthase Kinase 3 Beta Predicts Survival in Resected Adenocarcinoma of the Pancreas.
26236947 2015 AMPK inhibits MTDH expression via GSK3? and SIRT1 activation: potential role in triple negative breast cancer cell proliferation.
26209183 2015 Molecular dynamics simulation studies of GSK-3? ATP competitive inhibitors: understanding the factors contributing to selectivity.
26194614 2015 GSK3? Interactions with Amyloid Genes: An Autopsy Verification and Extension.
26186530 2015 The GSK3B gene confers risk for both major depressive disorder and schizophrenia in the Han Chinese population.
26139537 2015 Crosstalk between Akt/GSK3? signaling and dynamin-1 regulates clathrin-mediated endocytosis.
26129946 2016 Potential Role of Glycogen Synthase Kinase-3? in Regulation of Myocardin Activity in Human Vascular Smooth Muscle Cells.
26121043 2015 Resibufogenin Induces G1-Phase Arrest through the Proteasomal Degradation of Cyclin D1 in Human Malignant Tumor Cells.
26119563 2015 Stimulation of EphB2 attenuates tau phosphorylation through PI3K/Akt-mediated inactivation of glycogen synthase kinase-3?.
26097594 2015 Differential expression of GSK3? and pS9GSK3? in normal human tissues: can pS9GSK3? be an epithelial marker?
26095393 2015 Inhibition of GSK3? Stimulates BMP Signaling and Decreases SOST Expression Which Results in Enhanced Osteoblast Differentiation.
26088648 2015 MicroRNA-26b inhibits cell proliferation and cytokine secretion in human RASF cells via the Wnt/GSK-3?/?-catenin pathway.
26088133 2015 Protein Kinase A Opposes the Phosphorylation-dependent Recruitment of Glycogen Synthase Kinase 3? to A-kinase Anchoring Protein 220.
26063791 2015 Identification of a Novel Proto-oncogenic Network in Head and Neck Squamous Cell Carcinoma.
26049140 2015 A WNT1-regulated developmental gene cascade prevents dopaminergic neurodegeneration in adult En1(+/-) mice.
26022178 2015 NK cell function triggered by multiple activating receptors is negatively regulated by glycogen synthase kinase-3?.
25963821 2015 Tau reduction prevents A?-induced axonal transport deficits by blocking activation of GSK3?.
25941117 2015 Breast cancer cell line MCF7 escapes from G1/S arrest induced by proteasome inhibition through a GSK-3? dependent mechanism.
25935310 2015 Calcineurin B homologous protein 3 negatively regulates cardiomyocyte hypertrophy via inhibition of glycogen synthase kinase 3 phosphorylation.
25897075 2015 Rictor Undergoes Glycogen Synthase Kinase 3 (GSK3)-dependent, FBXW7-mediated Ubiquitination and Proteasomal Degradation.
25881103 2015 NMMHC IIA inhibition impedes tissue factor expression and venous thrombosis via Akt/GSK3?-NF-?B signalling pathways in the endothelium.
25868609 2015 Human recombinant H2 relaxin induces AKT and GSK3? phosphorylation and HTR-8/SVneo cell proliferation.
25865493 2015 Mutations Impairing GSK3-Mediated MAF Phosphorylation Cause Cataract, Deafness, Intellectual Disability, Seizures, and a Down Syndrome-like Facies.
25858425 2015 Akt and mitogen-activated protein kinase enhance C-type lectin-like receptor 2-mediated platelet activation by inhibition of glycogen synthase kinase 3?/?.
25846563 2015 Signal transducers and activators of transcription 3-induced metastatic potential in gastric cancer cells is enhanced by glycogen synthase kinase-3?.
25829335 2015 Glycogen synthase kinase-3 beta (GSK-3?) signaling: Implications for Parkinson's disease.
25797247 2015 GSK3 is required for rapalogs to induce degradation of some oncogenic proteins and to suppress cancer cell growth.
25771860 2015 ROCK2 promotes HCC proliferation by CEBPD inhibition through phospho-GSK3?/?-catenin signaling.
25754137 2015 Molecular dynamics study of the inhibitory effects of ChEMBL474807 on the enzymes GSK-3? and CDK-2.
25752456 2015 Glycogen synthase kinase 3? inhibition promotes human iTreg differentiation and suppressive function.
25728276 2015 Phosphorylation of Serine422 increases the stability and transactivation activities of human Osterix.
25673709 2015 The acetyltransferase Tip60 is a critical regulator of the differentiation-dependent amplification of human papillomaviruses.
25645517 2015 Expression and inactivation of glycogen synthase kinase 3 alpha/ beta and their association with the expression of cyclin D1 and p53 in oral squamous cell carcinoma progression.
25632187 2015 ?-escin reverses multidrug resistance through inhibition of the GSK3?/?-catenin pathway in cholangiocarcinoma.
25593505 2014 Lenticular cytoprotection, part 2: link between glycogen synthase kinase-3?, epithelial to mesenchymal transition, and mitochondrial depolarization.
25591548 2015 Overexpression of interleukin-18 protein reduces viability and induces apoptosis of tongue squamous cell carcinoma cells by activation of glycogen synthase kinase-3? signaling.
25575054 2015 [Oxidative stress promotes hepatocyte apoptosis mediated by glycogen synthase kinase 3?].
25561726 2015 Glycogen synthase kinase-3 (GSK3) inhibition induces prosurvival autophagic signals in human pancreatic cancer cells.
25550525 2015 A novel role for GSK3 in the regulation of the processes of human labour.
25541965 2014 GSK3? is increased in adipose tissue and skeletal muscle from women with gestational diabetes where it regulates the inflammatory response.
25532422 2015 Clinical significance of inactivated glycogen synthase kinase 3? in HPV-associated cervical cancer: Relationship with Wnt/?-catenin pathway activation.
25528666 2015 Semaphorin3A-induced axonal transport mediated through phosphorylation of Axin-1 by GSK3?.
25504636 2015 Glycogen synthase kinase 3? sustains invasion of glioblastoma via the focal adhesion kinase, Rac1, and c-Jun N-terminal kinase-mediated pathway.
25486988 2015 Effect of amyloid-? (A?) immunization on hyperphosphorylated tau: a potential role for glycogen synthase kinase (GSK)-3?.
25484286 2015 Blocking GSK3?-mediated dynamin1 phosphorylation enhances BDNF-dependent TrkB endocytosis and the protective effects of BDNF in neuronal and mouse models of Alzheimer's disease.
25420549 2015 Genetic variants of GSK3B are associated with biomarkers for Alzheimer's disease and cognitive function.
25398937 2015 Platelet PI3K? and GSK3 regulate thrombus stability at a high shear rate.
25394490 2015 GSK-3? dysregulation contributes to parkinson's-like pathophysiology with associated region-specific phosphorylation and accumulation of tau and ?-synuclein.
25390651 2014 Accelerated recovery of mitochondrial membrane potential by GSK-3? inactivation affords cardiomyocytes protection from oxidant-induced necrosis.
25380769 2015 Common variants in the MKL1 gene confer risk of schizophrenia.
25351705 2015 Common Polymorphisms in the GSK3? Gene May Contribute to the Pathogenesis of Alzheimer Disease: A Meta-Analysis.
25345732 2015 Lithium and GSK-3? promoter gene variants influence cortical gray matter volumes in bipolar disorder.
25344882 2015 Tight regulation between cell survival and programmed cell death in GBM stem-like cells by EGFR/GSK3b/PP2A signaling.
25344861 2014 Glycogen synthase kinase-3? inhibition depletes the population of prostate cancer stem/progenitor-like cells and attenuates metastatic growth.
25331948 2014 The spleen tyrosine kinase (Syk) regulates Alzheimer amyloid-? production and Tau hyperphosphorylation.
25327559 2014 A screen for transcription factor targets of glycogen synthase kinase-3 highlights an inverse correlation of NF?B and androgen receptor signaling in prostate cancer.
25301365 2014 Membrane androgen receptor down-regulates c-src-activity and beta-catenin transcription and triggers GSK-3beta-phosphorylation in colon tumor cells.
25265336 2014 miR-135b contributes to the radioresistance by targeting GSK3? in human glioblastoma multiforme cells.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25231989 2014 Acetylcholine receptor (AChR) clustering is regulated both by glycogen synthase kinase 3? (GSK3?)-dependent phosphorylation and the level of CLIP-associated protein 2 (CLASP2) mediating the capture of microtubule plus-ends.
25219467 2015 Cross talk between PI3K-AKT-GSK-3? and PP2A pathways determines tau hyperphosphorylation.
25194152 2015 Unremitting cell proliferation in the secretory phase of eutopic endometriosis: involvement of pAkt and pGSK3?.
25187518 2014 Translocation of glycogen synthase kinase-3? (GSK-3?), a trigger of permeability transition, is kinase activity-dependent and mediated by interaction with voltage-dependent anion channel 2 (VDAC2).
25183803 2014 Protein kinase R-like endoplasmic reticulum kinase and glycogen synthase kinase-3?/? regulate foam cell formation.
25172662 2014 Protocadherin 9 inhibits epithelial-mesenchymal transition and cell migration through activating GSK-3? in hepatocellular carcinoma.
25157753 2014 Glycogen synthase kinase-3? is associated with the prognosis of hepatocellular carcinoma and may mediate the influence of type 2 diabetes mellitus on hepatocellular carcinoma.
25145299 2015 CXCR4 promotes GSK3? expression in pancreatic cancer cells via the Akt pathway.
25141968 2014 The association between single nucleotide polymorphisms of GSK 3? gene and sporadic Alzheimer's disease in a cohort of southern Chinese Han population.
25138042 2014 Ser9-phosphorylated GSK3? induced by 14-3-3? actively antagonizes cell apoptosis in a NF-?B dependent manner.
25135221 2014 A novel ?-catenin signaling pathway activated by IL-1? leads to the onset of epithelial-mesenchymal transition in breast cancer cells.
25124796 2014 Snail regulated by PKC/GSK-3? pathway is crucial for EGF-induced epithelial-mesenchymal transition (EMT) of cancer cells.
25123268 2014 miR-203a regulates proliferation, migration, and apoptosis by targeting glycogen synthase kinase-3? in human renal cell carcinoma.
25118933 2014 The protease Omi regulates mitochondrial biogenesis through the GSK3?/PGC-1? pathway.
25114899 2014 Sensitization of cancer cells through reduction of total Akt and downregulation of salinomycin-induced pAkt, pGSk3?, pTSC2, and p4EBP1 by cotreatment with MK-2206.
25088797 2014 AKT/GSK-3? regulates stability and transcription of snail which is crucial for bFGF-induced epithelial-mesenchymal transition of prostate cancer cells.
25075421 2014 [Role of glycogen synthase kinase-3? in the pathogenesis of mental disorders].
25069254 2013 [Haplotype analysis of GSK-3beta gene polymorphisms and smoking behavior].
25059120 2014 Akt2 mediates TGF-?1-induced epithelial to mesenchymal transition by deactivating GSK3?/snail signaling pathway in renal tubular epithelial cells.
25053419 2014 GSK3 protein positively regulates type I insulin-like growth factor receptor through forkhead transcription factors FOXO1/3/4.
25041379 2015 Region-specific dysregulation of glycogen synthase kinase-3? and ?-catenin in the postmortem brains of subjects with bipolar disorder and schizophrenia.
25010341 2014 Insights into the interactions between maleimide derivates and GSK3? combining molecular docking and QSAR.
24994693 2014 A combined study of GSK3? polymorphisms and brain network topological metrics in major depressive disorder.
24992082 Haplotype analysis of GSK-3? gene polymorphisms in bipolar disorder lithium responders and nonresponders.
24984063 2014 GSK3A is redundant with GSK3B in modulating drug resistance and chemotherapy-induced necroptosis.
24982245 2014 GSK-3?-regulated N-acetyltransferase 10 is involved in colorectal cancer invasion.
24976009 2014 YAP/TAZ incorporation in the ?-catenin destruction complex orchestrates the Wnt response.
24939300 2014 Downregulation of LncRNAH19 and MiR-675 promotes migration and invasion of human hepatocellular carcinoma cells through AKT/GSK-3?/Cdc25A signaling pathway.
24929931 2014 Hirano bodies differentially modulate cell death induced by tau and the amyloid precursor protein intracellular domain.
24929537 2014 Meta-analysis demonstrates lack of association of the GSK3B -50C/T polymorphism with risk of bipolar disorder.
24901984 2014 Glycogen synthase kinase (GSK) 3? phosphorylates and protects nuclear myosin 1c from proteasome-mediated degradation to activate rDNA transcription in early G1 cells.
24899689 2014 Cardiac fibroblast glycogen synthase kinase-3? regulates ventricular remodeling and dysfunction in ischemic heart.
24854430 2015 Phosphorylation of glycogen synthase kinase-3? in metabolically abnormal obesity affects immune stimulation-induced cytokine production.
24802394 2014 JNK and AKT/GSK3? signaling pathways converge to regulate periodontal ligament cell survival involving XIAP.
24779391 2014 MAPT rs242562 and GSK3B rs334558 are associated with Parkinson's Disease in central China.
24760594 2015 The elongation of primary cilia via the acetylation of ?-tubulin by the treatment with lithium chloride in human fibroblast KD cells.
24742671 2014 Glycogen synthase kinase-3? stabilizes the interleukin (IL)-22 receptor from proteasomal degradation in murine lung epithelia.
24704462 2014 Regulation of MDA-MB-231 cell proliferation by GSK-3? involves epigenetic modifications under high glucose conditions.
24681994 2014 Association of glycogen synthase kinase-3? with Parkinson's disease (review).
24677591 2014 Glycogen synthase kinase 3 beta gene structural variants as possible risk factors of bipolar depression.
24677550 2014 GSK3? regulates oligodendrogenesis in the dorsal microdomain of the subventricular zone via Wnt-?-catenin signaling.
24675460 2014 Differential activity of GSK-3 isoforms regulates NF-?B and TRAIL- or TNF? induced apoptosis in pancreatic cancer cells.
24634935 2013 Octreotide stimulates somatostatin receptor-induced apoptosis of SW480 colon cancer cells by activation of glycogen synthase kinase-3?, A Wnt/?-catenin pathway modulator.
24634145 2014 Localized changes to glycogen synthase kinase-3 and collapsin response mediator protein-2 in the Huntington's disease affected brain.
24626091 2014 Maintaining glycogen synthase kinase-3 activity is critical for mTOR kinase inhibitors to inhibit cancer cell growth.
24577092 2014 Glycogen synthase kinase 3? represses MYOGENIN function in alveolar rhabdomyosarcoma.
24571487 2014 Inhibition of mTORC1 induces loss of E-cadherin through AKT/GSK-3? signaling-mediated upregulation of E-cadherin repressor complexes in non-small cell lung cancer cells.
24549719 2014 Lithium chloride decreases proliferation and migration of C6 glioma cells harboring isocitrate dehydrogenase 2 mutant via GSK-3?.
24535599 2014 Phosphorylation of Grb14 BPS domain by GSK-3 correlates with complex forming of Grb14 and insulin receptor.
24531650 2014 Oxidative stress promotes D-GalN/LPS-induced acute hepatotoxicity by increasing glycogen synthase kinase 3? activity.
24507683 2014 Expression of PI3-K, PKB and GSK-3 ? in the skeletal muscle tissue of gestational diabetes mellitus.
24486183 2014 Association between GSK3? gene and increased impulsivity in bipolar disorder.
24468793 2014 Inhibition of TBK1 attenuates radiation-induced epithelial-mesenchymal transition of A549 human lung cancer cells via activation of GSK-3? and repression of ZEB1.
24451375 2014 Induction of Gsk3?-?-TrCP interaction is required for late phase stabilization of ?-catenin in canonical Wnt signaling.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24427901 2013 [The relationship between glycogen synthase kinase - 3beta -1727A/T x -50T/C genetic polymorphisms and nicotine dependence].
24425879 2014 GSK-3? protein phosphorylates and stabilizes HLXB9 protein in insulinoma cells to form a targetable mechanism of controlling insulinoma cell proliferation.
24411062 2014 Multiplex immunoassay analysis of plasma shows prominent upregulation of growth factor activity pathways linked to GSK3? signaling in bipolar patients.
24398687 2014 A colon cancer-derived mutant of Krüppel-like factor 5 (KLF5) is resistant to degradation by glycogen synthase kinase 3? (GSK3?) and the E3 ubiquitin ligase F-box and WD repeat domain-containing 7? (FBW7?).
24391509 2014 NCYM, a Cis-antisense gene of MYCN, encodes a de novo evolved protein that inhibits GSK3? resulting in the stabilization of MYCN in human neuroblastomas.
24390485 2014 FOXL2 posttranslational modifications mediated by GSK3? determine the growth of granulosa cell tumours.
24334212 2014 GSK3?, CREB, and BDNF in peripheral blood of patients with Alzheimer's disease and depression.
24333432 2014 GSK3? negatively regulates HIF1? mRNA stability via nucleolin in the MG63 osteosarcoma cell line.
24327518 2014 Inhibition of GSK-3 induces differentiation and impaired glucose metabolism in renal cancer.
24316184 2014 Glycogen synthase kinase-3 (GSK3) controls deoxyglucose-induced mitochondrial biogenesis in human neuroblastoma SH-SY5Y cells.
24312592 2013 Polarized regulation of glycogen synthase kinase-3? is important for glioma cell invasion.
24303084 2013 Galectin-3 silencing inhibits epirubicin-induced ATP binding cassette transporters and activates the mitochondrial apoptosis pathway via ?-catenin/GSK-3? modulation in colorectal carcinoma.
24282277 2014 GSK3 inhibitors regulate MYCN mRNA levels and reduce neuroblastoma cell viability through multiple mechanisms, including p53 and Wnt signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24239461 2014 Boldine induces cell cycle arrest and apoptosis in T24 human bladder cancer cell line via regulation of ERK, AKT, and GSK-3?.
24228880 2013 Glycogen synthase kinase-3? is involved in C-reactive protein-induced endothelial cell activation.
24188406 2014 Curcumin attenuates amyloid-?-induced tau hyperphosphorylation in human neuroblastoma SH-SY5Y cells involving PTEN/Akt/GSK-3? signaling pathway.
24165324 2014 Leucine-rich repeat kinase 2 regulates tau phosphorylation through direct activation of glycogen synthase kinase-3?.
24158777 2014 Glycogen synthase kinase 3 beta (GSK3?) at the tip of neuronal development and regeneration.
24150227 2013 Genetic and clinical factors predict lithium's effects on PER2 gene expression rhythms in cells from bipolar disorder patients.
24142875 2013 Glycogen synthase kinase 3 promotes p53 mRNA translation via phosphorylation of RNPC1.
24134204 2014 A novel DYRK1B inhibitor AZ191 demonstrates that DYRK1B acts independently of GSK3? to phosphorylate cyclin D1 at Thr(286), not Thr(288).
24132507 2014 Saturated free fatty acid sodium palmitate-induced lipoapoptosis by targeting glycogen synthase kinase-3? activation in human liver cells.
24117074 2013 20(S)-protopanaxadiol triggers mitochondrial-mediated apoptosis in human lung adenocarcinoma A549 cells via inhibiting the PI3K/Akt signaling pathway.
24115276 2014 The regulation and deregulation of Wnt signaling by PARK genes in health and disease.
24112793 2014 Interactions between GSK3? and amyloid genes explain variance in amyloid burden.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24065186 2013 14-3-3? regulates the proliferation of glioma cells through the GSK3?/?-catenin signaling pathway.
24038789 2014 Stromal cell derived factor-1? promotes C-Kit+ cardiac stem/progenitor cell quiescence through casein kinase 1? and GSK3?.
24035907 2013 Expression and regulation of glycogen synthase kinase 3 in human neutrophils.
24027432 2013 COP1 and GSK3? cooperate to promote c-Jun degradation and inhibit breast cancer cell tumorigenesis.
24025791 2013 RNAi screening identifies GSK3? as a regulator of DRP1 and the neuroprotection of lithium chloride against elevated pressure involved in downregulation of DRP1.
24022664 2014 The tumor suppressor LKB1 antagonizes WNT signaling pathway through modulating GSK3? activity in cell growth of esophageal carcinoma.
24001613 2013 Nir1 promotes invasion of breast cancer cells by binding to chemokine (C-C motif) ligand 18 through the PI3K/Akt/GSK3?/Snail signalling pathway.
24000012 2013 RACK1 promotes the proliferation of THP1 acute myeloid leukemia cells.
23983127 2013 Succinate dehydrogenase 5 (SDH5) regulates glycogen synthase kinase 3?-?-catenin-mediated lung cancer metastasis.
23959174 2013 Ribophorin II regulates breast tumor initiation and metastasis through the functional suppression of GSK3?.
23951236 2013 GSK3B and MAPT polymorphisms are associated with grey matter and intracranial volume in healthy individuals.
23911749 2013 GSK3? is a checkpoint for TNF-?-mediated impaired osteogenic differentiation of mesenchymal stem cells in inflammatory microenvironments.
23905999 2014 A longitudinal FDG-PET study of transgenic mice overexpressing GSK- 3? in the brain.
23900020 2014 Dynamic analysis of histamine-mediated attenuation of acetylcholine-induced sweating via GSK3? activation.
23896637 The negative cell cycle regulators, p27(Kip1), p18(Ink4c), and GSK-3, play critical role in maintaining quiescence of adult human pancreatic ?-cells and restrict their ability to proliferate.
23880761 2013 Progesterone receptor A stability is mediated by glycogen synthase kinase-3? in the Brca1-deficient mammary gland.
23874688 2013 Inhibition of GSK 3? activity is associated with excessive EZH2 expression and enhanced tumour invasion in nasopharyngeal carcinoma.
23853095 2013 Per-Arnt-Sim kinase regulates pancreatic duodenal homeobox-1 protein stability via phosphorylation of glycogen synthase kinase 3? in pancreatic ?-cells.
23851680 2013 Anti-dengue virus nonstructural protein 1 antibodies cause NO-mediated endothelial cell apoptosis via ceramide-regulated glycogen synthase kinase-3? and NF-?B activation.
23851495 2014 GSK3? controls epithelial-mesenchymal transition and tumor metastasis by CHIP-mediated degradation of Slug.
23846217 2013 ER stress-mediated apoptosis induced by celastrol in cancer cells and important role of glycogen synthase kinase-3? in the signal network.
23845472 2013 The ?5/focal adhesion kinase/glycogen synthase kinase 3? integrin pathway in high-grade osteosarcoma: a protein expression profile predictive of response to neoadjuvant chemotherapy.
23824844 2013 Requirement for active glycogen synthase kinase-3? in TGF-?1 upregulation of connective tissue growth factor (CCN2/CTGF) levels in human gingival fibroblasts.
23818587 2013 Dysregulation of PAD4-mediated citrullination of nuclear GSK3? activates TGF-? signaling and induces epithelial-to-mesenchymal transition in breast cancer cells.
23798682 2013 An unbiased approach to identifying tau kinases that phosphorylate tau at sites associated with Alzheimer disease.
23768967 2013 Glycogen synthase kinase-3? (GSK-3?) and its dysregulation in glioblastoma multiforme.
23761130 2013 Leucine zipper tumor suppressor 2 inhibits cell proliferation and regulates Lef/Tcf-dependent transcription through Akt/GSK3? signaling pathway in lung cancer.
23729362 2013 Inhibition of GSK3B bypass drug resistance of p53-null colon carcinomas by enabling necroptosis in response to chemotherapy.
23685991 2014 Glycogen synthase kinase 3 negatively regulates IFN regulatory factor 3 transactivation through phosphorylation at its linker region.
23673211 2013 Inhibition of cytoplasmic GSK-3? increases cisplatin resistance through activation of Wnt/?-catenin signaling in A549/DDP cells.
23669633 2013 Synthesis and biological evaluation of 3-benzisoxazolyl-4-indolylmaleimides as potent, selective inhibitors of glycogen synthase kinase-3?.
23649588 2013 Maintenance of stem cell self-renewal in head and neck cancers requires actions of GSK3? influenced by CD44 and RHAMM.
23628795 2013 The association between glycogen synthase kinase 3 beta polymorphisms and Parkinson's disease susceptibility: a meta-analysis.
23623971 2013 Glycogen synthase kinase 3 regulates expression of nuclear factor-erythroid-2 related transcription factor-1 (Nrf1) and inhibits pro-survival function of Nrf1.
23621307 2013 Understanding the relationship between GSK-3 and Alzheimer's disease: a focus on how GSK-3 can modulate synaptic plasticity processes.
23615537 2013 c-Src regulates cell cycle proteins expression through protein kinase B/glycogen synthase kinase 3 beta and extracellular signal-regulated kinases 1/2 pathways in MCF-7 cells.
23614534 2013 Nuclear GSK-3? segregation in desmoid-type fibromatosis.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23598903 2013 Association of GSK-3? genetic variation with GSK-3? expression, prefrontal cortical thickness, prefrontal physiology, and schizophrenia.
23583197 2013 Development of Akt-activated GSK3? inhibitory peptide.
23582741 2013 Glycogen synthase kinase-3 beta regulates Snail and ?-catenin expression during Fas-induced epithelial-mesenchymal transition in gastrointestinal cancer.
23559006 2013 GSK-3? signaling determines autophagy activation in the breast tumor cell line MCF7 and inclusion formation in the non-tumor cell line MCF10A in response to proteasome inhibition.
23551536 2013 An immunohistochemical evaluation of the proteins Wnt1 and glycogen synthase kinase (GSK)-3? in invasive breast carcinomas.
23525328 2013 Single-nucleotide polymorphisms of GSK3B, GAB2 and SORL1 in late-onset Alzheimer's disease: interactions with the APOE genotype.
23505128 2013 Identification and analysis of glycogen synthase kinase 3 beta1 interactome.
23463670 2013 Sorafenib induces endometrial carcinoma apoptosis by inhibiting Elk-1-dependent Mcl-1 transcription and inducing Akt/GSK3?-dependent protein degradation.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23453640 2013 Genetic variability at IMPA2, INPP1 and GSK3? increases the risk of suicidal behavior in bipolar patients.
23442801 2013 Glycogen synthase kinase 3 ? activity is required for hBora/Aurora A-mediated mitotic entry.
23440732 2013 GSK-3? polymorphism discriminates bipolar disorder and schizophrenia: a systematic meta-analysis.
23432902 2013 MuRF-1 and p-GSK3? expression in muscle atrophy of cirrhosis.
23413973 2013 Efficient derivation of lateral plate and paraxial mesoderm subtypes from human embryonic stem cells through GSKi-mediated differentiation.
23408967 2013 Aberrant glycogen synthase kinase 3? is involved in pancreatic cancer cell invasion and resistance to therapy.
23408424 2013 Extracellular signal-regulated kinase and glycogen synthase kinase 3? regulate gephyrin postsynaptic aggregation and GABAergic synaptic function in a calpain-dependent mechanism.
23402899 2013 Disease-modified glycogen synthase kinase-3? intervention by melatonin arrests the pathology and memory deficits in an Alzheimer's animal model.
23389968 2013 Nuclear expression of glycogen synthase kinase-3? and lack of membranous ?-catenin is correlated with poor survival in colon cancer.
23389291 2013 Regulation of proteolytic cleavage of retinoid X receptor-? by GSK-3?.
23379509 2013 An emerging role for Wnt and GSK3 signaling pathways in schizophrenia.
23369789 2013 GSK-3 inhibition: achieving moderate efficacy with high selectivity.
23352529 2013 Glycogen synthase kinase 3 in chronic rhinosinusitis: two faces of a single enzyme in one disease.
23349801 2013 Protein kinase C regulates human pluripotent stem cell self-renewal.
23332125 2013 ARTD10 substrate identification on protein microarrays: regulation of GSK3? by mono-ADP-ribosylation.
23328640 2013 Targeting glycogen synthase kinase-3? to prevent hyperoxia-induced lung injury in neonatal rats.
23314850 2013 SLIT2 inhibits cell migration in colorectal cancer through the AKT-GSK3? signaling pathway.
23288365 2013 Direct GSK-3? inhibition enhances mesenchymal stromal cell migration by increasing expression of ?-PIX and CXCR4.
23279147 2012 The peripheral messenger RNA expression of glycogen synthase kinase-3? genes in Alzheimer's disease patients: a preliminary study.
23277198 2013 GSK3? phosphorylates newly identified site in the proline-alanine-rich region of cardiac myosin-binding protein C and alters cross-bridge cycling kinetics in human: short communication.
23243017 2013 Dual inhibition of Bcl-2 and Bcl-xL strikingly enhances PI3K inhibition-induced apoptosis in human myeloid leukemia cells through a GSK3- and Bim-dependent mechanism.
23211630 2013 ROCK2 regulates bFGF-induced proliferation of SH-SY5Y cells through GSK-3? and ?-catenin pathway.
23202730 2013 Inhibition of GSK3?-mediated BACE1 expression reduces Alzheimer-associated phenotypes.
23192081 2012 Activation of GABA(B) receptors inhibits protein kinase B/glycogen synthase kinase 3 signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23185298 2012 GSK3beta-mediated Drp1 phosphorylation induced elongated mitochondrial morphology against oxidative stress.
23185275 2012 Targeting of CRMP-2 to the primary cilium is modulated by GSK-3?.
23184735 2013 How calcium inhibits the magnesium-dependent kinase gsk3?: a molecular simulation study.
23184662 2013 Phosphorylation of eukaryotic elongation factor 2 (eEF2) by cyclin A-cyclin-dependent kinase 2 regulates its inhibition by eEF2 kinase.
23166798 2012 Sidestream smoke exposure increases the susceptibility of airway epithelia to adenoviral infection.
23164673 2013 The glycogen synthase kinase-3?/nuclear factor-kappa B pathway is involved in cinobufagin-induced apoptosis in cultured osteosarcoma cells.
23160194 2012 GSK3? mediates muscle pathology in myotonic dystrophy.
23110823 2013 Altered Wnt signalling in the teenage suicide brain: focus on glycogen synthase kinase-3? and ?-catenin.
23104438 2012 The nuclear localization of glycogen synthase kinase 3? is required its putative PY-nuclear localization sequences.
23085750 2013 GSK3? phosphorylation of the KLF6 tumor suppressor promotes its transactivation of p21.
23077590 2012 Non-canonical Smads phosphorylation induced by the glutamate release inhibitor, riluzole, through GSK3 activation in melanoma.
23030648 2012 Possible association of the GSK3? gene with the anxiety symptoms of major depressive disorder and P300 waveform.
23023215 2012 GSK3? and CREB3 gene expression profiling in benign and malignant salivary gland tumors.
23021822 2013 Glycogen synthase kinase 3? gene polymorphisms may be associated with bipolar I disorder and the therapeutic response to lithium.
23010592 2012 NOK/STYK1 interacts with GSK-3? and mediates Ser9 phosphorylation through activated Akt.
23002080 2012 Circadian gating of epithelial-to-mesenchymal transition in breast cancer cells via melatonin-regulation of GSK3?.
22999923 2012 R280T mutation of p53 gene promotes proliferation of human glioma cells through GSK-3?/PTEN pathway.
22990942 2013 Lithium and GSK3-? promoter gene variants influence white matter microstructure in bipolar disorder.
22988876 2012 The importance of Wnt signalling for neurodegeneration in Parkinson's disease.
22976805 2012 GSK3? and cyclin D1 expression predicts outcome in early breast cancer patients.
22970250 2012 Expression profiling of stem cell-related genes in neoadjuvant-treated gastric cancer: a NOTCH2, GSK3B and ?-catenin gene signature predicts survival.
22965877 2012 NUB1 modulation of GSK3? reduces tau aggregation.
22960426 2013 TGF? overrides HNF4? tumor suppressing activity through GSK3? inactivation: implication for hepatocellular carcinoma gene therapy.
22936801 2012 A phytoestrogen diarylheptanoid mediates estrogen receptor/Akt/glycogen synthase kinase 3? protein-dependent activation of the Wnt/?-catenin signaling pathway.
22933777 2012 GSK3?/axin-1/?-catenin complex is involved in semaphorin3A signaling.
22910909 2012 Hyperphosphorylation of Tau induced by naturally secreted amyloid-? at nanomolar concentrations is modulated by insulin-dependent Akt-GSK3? signaling pathway.
22898789 2012 Epithelial cell adhesion molecules and epithelial mesenchymal transition (EMT) markers in Ewing's sarcoma family of tumors (ESFTs). Do they offer any prognostic significance?
22863953 2012 Glycogen synthase kinase 3? inhibition prevents monocyte migration across brain endothelial cells via Rac1-GTPase suppression and down-regulation of active integrin conformation.
22855295 2012 Regulation of endothelial cell morphogenesis by the protein kinase D (PKD)/glycogen synthase kinase 3 (GSK3)? pathway.
22834106 2012 [Association between lithium sensitivity and GSK3beta gene polymorphisms in bipolar disorder].
22832604 2011 Interactions of human truncated DISC1 proteins: implications for schizophrenia.
22832527 2011 Genetic regulation of Nrxn1 [corrected] expression: an integrative cross-species analysis of schizophrenia candidate genes.
22825252 2012 Reconciling the different roles of Gsk3? in "naïve" and "primed" pluripotent stem cells.
22815195 2012 GSK3? reduces risk of sporadic Parkinson's disease in ethnic Chinese.
22814751 2012 ADP-stimulated activation of Akt during integrin outside-in signaling promotes platelet spreading by inhibiting glycogen synthase kinase-3?.
22810307 2012 GSK3? inhibition blocks melanoma cell/host interactions by downregulating N-cadherin expression and decreasing FAK phosphorylation.
22785398 2012 Association of a GSK-3? polymorphism with brain resting-state function in amnestic-type mild cognitive impairment.
22775567 2012 Inhibition of GSK-3? enhances neural differentiation in unrestricted somatic stem cells.
22773696 2012 Glycogen synthase kinase-3?/?-catenin signaling regulates neonatal lung mesenchymal stromal cell myofibroblastic differentiation.
22773187 2012 Dual functions of DP1 promote biphasic Wnt-on and Wnt-off states during anteroposterior neural patterning.
22771494 2012 Glycogen synthase kinase-3? is involved in ligand-dependent activation of transcription and cellular localization of the glucocorticoid receptor.
22751928 2012 Structural and functional characterization of Nrf2 degradation by the glycogen synthase kinase 3/?-TrCP axis.
22732552 2012 Glycogen synthase kinase-3? regulates leucine-309 demethylation of protein phosphatase-2A via PPMT1 and PME-1.
22710716 2013 GSK3-SCF(FBXW7) targets JunB for degradation in G2 to preserve chromatid cohesion before anaphase.
22707636 2012 TNF-? induces epithelial-mesenchymal transition of renal cell carcinoma cells via a GSK3?-dependent mechanism.
22699938 2012 Kindlin 2 forms a transcriptional complex with ?-catenin and TCF4 to enhance Wnt signalling.
22690042 2012 Activated protein C induces endoplasmic reticulum stress and attenuates lipopolysaccharide-induced apoptosis mediated by glycogen synthase kinase-3?.
22687243 2012 Diverse regulation of AKT and GSK-3? by O-GlcNAcylation in various types of cells.
22682247 2012 Wnt signaling through inhibition of ?-catenin degradation in an intact Axin1 complex.
22679108 2012 GSK-3 promotes cell survival, growth, and PAX3 levels in human melanoma cells.
22661511 2012 Aldose reductase modulates cardiac glycogen synthase kinase-3? phosphorylation during ischemia-reperfusion.
22658982 2012 Association between glycogen synthase kinase-3? gene polymorphisms and attention deficit hyperactivity disorder in Korean children: a preliminary study.
22586270 2012 Identification of estrogen receptor ? as a SUMO-1 target reveals a novel phosphorylated sumoylation motif and regulation by glycogen synthase kinase 3?.
22577147 2012 Specific serine-proline phosphorylation and glycogen synthase kinase 3?-directed subcellular targeting of stathmin 3/Sclip in neurons.
22539723 2012 GSK3-TIP60-ULK1 signaling pathway links growth factor deprivation to autophagy.
22539113 2012 Distinct expression and activity of GSK-3? and GSK-3? in prostate cancer.
22534782 2012 Glycogen synthase kinase-3?, NF-?B signaling, and tumorigenesis of human osteosarcoma.
22514281 2012 Glycogen synthase kinase 3? (GSK3?) modulates antiviral activity of zinc-finger antiviral protein (ZAP).
22470507 2012 Oncogenic function of DACT1 in colon cancer through the regulation of ?-catenin.
22460328 2012 Bip enhanced the association of GSK-3? with tau during ER stress both in vivo and in vitro.
22455883 2012 [Expression and significance of p-AKT, p-GSK3? and ?-catenin in epithelial carcinoma of ovary].
22419736 2012 Neuropathogenic role of adenylate kinase-1 in A?-mediated tau phosphorylation via AMPK and GSK3?.
22419096 Protein kinase GSK3? regulates tumor suppressor Pdcd4 expression in lung cancer cells.
22413565 2011 [The relationship between glycogen synthase kinase-3 beta (GSK3B) -50T/C -1727A/T polymorphisms and alcoholism].
22384031 2012 GSK3 inhibitor-BIO regulates proliferation of immortalized pancreatic mesenchymal stem cells (iPMSCs).
22363707 2012 Phosphorylation of LCRMP-1 by GSK3? promotes filopoda formation, migration and invasion abilities in lung cancer cells.
22349353 2012 Kisspeptin-10 inhibits cell migration in vitro via a receptor-GSK3 beta-FAK feedback loop in HTR8SVneo cells.
22286758 2012 Inhibiting oncogenic signaling by sorafenib activates PUMA via GSK3? and NF-?B to suppress tumor cell growth.
22262776 2012 Targeting of GSK3? promotes imatinib-mediated apoptosis in quiescent CD34+ chronic myeloid leukemia progenitors, preserving normal stem cells.
22262180 2012 GSK3? regulates Bcl2L12 and Bcl2L12A anti-apoptosis signaling in glioblastoma and is inhibited by LiCl.
22246236 2012 Migfilin regulates esophageal cancer cell motility through promoting GSK-3?-mediated degradation of ?-catenin.
22243669 2012 Expression of GSK-3? in renal allograft tissue and its significance in pathogenesis of chronic allograft dysfunction.
22234583 2012 Resveratrol downregulates Akt/GSK and ERK signalling pathways in OVCAR-3 ovarian cancer cells.
22214783 2012 Down-regulation of amyloid-? through AMPK activation by inhibitors of GSK-3? in SH-SY5Y and SH-SY5Y-A?PP695 cells.
22201186 2012 Inhibition of glycogen synthase kinase-3 activity triggers an apoptotic response in pancreatic cancer cells through JNK-dependent mechanisms.
22193544 2012 WW domain-containing oxidoreductase promotes neuronal differentiation via negative regulation of glycogen synthase kinase 3?.
22184106 2012 Prolyl isomerase Pin1 promotes amyloid precursor protein (APP) turnover by inhibiting glycogen synthase kinase-3? (GSK3?) activity: novel mechanism for Pin1 to protect against Alzheimer disease.
22179823 2012 NPM-ALK signals through glycogen synthase kinase 3? to promote oncogenesis.
22144179 2012 GSK-3? regulates cell growth, migration, and angiogenesis via Fbw7 and USP28-dependent degradation of HIF-1?.
22142472 2012 Serine-threonine kinase 38 is regulated by glycogen synthase kinase-3 and modulates oxidative stress-induced cell death.
22140263 2012 Myeloid cell IL-10 production in response to leishmania involves inactivation of glycogen synthase kinase-3? downstream of phosphatidylinositol-3 kinase.
22102280 2012 Evidence for irreversible inhibition of glycogen synthase kinase-3? by tideglusib.
22093618 2012 Re-expression of miR-199a suppresses renal cancer cell proliferation and survival by targeting GSK-3?.
22087308 2011 DNA damage stress and inhibition of Jak2-V617F cause its degradation and synergistically induce apoptosis through activation of GSK3?.
22048123 2012 In vivo P2X7 inhibition reduces amyloid plaques in Alzheimer's disease through GSK3? and secretases.
22039301 2011 Glycogen synthase kinase-3? is a prosurvival signal for the maintenance of human mast cell homeostasis.
22039048 2011 Adiponectin stimulates proliferation of adult hippocampal neural stem/progenitor cells through activation of p38 mitogen-activated protein kinase (p38MAPK)/glycogen synthase kinase 3? (GSK-3?)/?-catenin signaling cascade.
21996267 2011 Genetic association and identification of a functional SNP at GSK3? for schizophrenia susceptibility.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21985244 2011 Stimulatory effect of ?-synuclein on the tau-phosphorylation by GSK-3?.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21898401 2012 Glycogen synthase kinase-3? is critical for interferon-?-induced serotonin uptake in human Jurkat T cells.
21887250 2011 Critical role of PI3K/Akt/GSK3? in motoneuron specification from human neural stem cells in response to FGF2 and EGF.
21873331 2011 Inhibition of glycogen synthase kinase 3? induces dermal fibrosis by activation of the canonical Wnt pathway.
21821001 2011 Increased galectin-3 facilitates leukemia cell survival from apoptotic stimuli.
21795403 2011 GSK3? inactivation induces apoptosis of leukemia cells by repressing the function of c-Myb.
21790007 [Expression of GSK3B gene in peripheral blood in patient with Parkinson's disease].
21757741 2011 Glycogen synthase kinase-3beta (GSK3beta) negatively regulates PTTG1/human securin protein stability, and GSK3beta inactivation correlates with securin accumulation in breast tumors.
21743491 2012 Microsomal prostaglandin E synthase-1 promotes hepatocarcinogenesis through activation of a novel EGR1/?-catenin signaling axis.
21737790 2011 Differential roles of GSK-3? during myocardial ischemia and ischemia/reperfusion.
21725365 2012 Sex differences in the GSK3?-mediated survival of adherent leukemic progenitors.
21711983 2012 A role for Akt and glycogen synthase kinase-3 as integrators of dopamine and serotonin neurotransmission in mental health.
21700708 2011 Inducible nitric-oxide synthase and nitric oxide donor decrease insulin receptor substrate-2 protein expression by promoting proteasome-dependent degradation in pancreatic beta-cells: involvement of glycogen synthase kinase-3beta.
21671254 2011 Inhibition of cyclin-dependent kinase 5 but not of glycogen synthase kinase 3-? prevents neurite retraction and tau hyperphosphorylation caused by secretable products of human T-cell leukemia virus type I-infected lymphocytes.
21661417 STAT3 and beta-catenin signaling pathway may affect GSK-3beta expression in hepatocellular carcinoma.
21632881 2011 Cardiac-specific mindin overexpression attenuates cardiac hypertrophy via blocking AKT/GSK3? and TGF-?1-Smad signalling.
21613824 2011 Troglitazone, a PPAR agonist, inhibits human prostate cancer cell growth through inactivation of NF?B via suppression of GSK-3? expression.
21609933 2011 Upregulation of glycogen synthase kinase 3? in human colorectal adenocarcinomas correlates with accumulation of CTNNB1.
21571466 2012 Expression of mismatch repair gene PMS2 in nasopharyngeal carcinoma and regulation by glycogen synthase kinase-3? in vivo and in vitro.
21549170 2011 The impact of glycogen synthase kinase 3? gene on psychotic mania in bipolar disorder patients.
21527318 2011 GSK3? genetic variability in patients with Multiple Sclerosis.
21471285 2011 The multitargeted receptor tyrosine kinase inhibitor linifanib (ABT-869) induces apoptosis through an Akt and glycogen synthase kinase 3?-dependent pathway.
21460223 2011 Age-dependent accumulation of soluble amyloid beta (Abeta) oligomers reverses the neuroprotective effect of soluble amyloid precursor protein-alpha (sAPP(alpha)) by modulating phosphatidylinositol 3-kinase (PI3K)/Akt-GSK-3beta pathway in Alzheimer mouse model.
21443865 2011 Association analysis of GSK3B and MAPT polymorphisms with Alzheimer's disease in Han Chinese.
21441955 2011 Mutant K-Ras increases GSK-3? gene expression via an ETS-p300 transcriptional complex in pancreatic cancer.
21436692 2011 Overexpression of glycogen synthase kinase-3 in ovarian carcinoma cells with acquired paclitaxel resistance.
21435461 2011 Nutritional limitation sensitizes mammalian cells to GSK-3? inhibitors and leads to growth impairment.
21422248 2011 Convergence of the mammalian target of rapamycin complex 1- and glycogen synthase kinase 3-?-signaling pathways regulates the innate inflammatory response.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21343617 2011 ER stress inhibits mTORC2 and Akt signaling through GSK-3?-mediated phosphorylation of rictor.
21334395 2011 Glycogen synthase kinase 3 involvement in the excessive proinflammatory response to LPS in patients with decompensated cirrhosis.
21328461 2011 ACSL3 and GSK-3? are essential for lipid upregulation induced by endoplasmic reticulum stress in liver cells.
21317289 2011 Dual Phosphorylation of suppressor of fused (Sufu) by PKA and GSK3beta regulates its stability and localization in the primary cilium.
21314327 2011 Platelet GSK3B activity in patients with late-life depression: marker of depressive episode severity and cognitive impairment?
21303975 2011 Raf kinase inhibitor protein RKIP enhances signaling by glycogen synthase kinase-3?.
21278490 GSK-3 inactivation or depletion promotes ?-cell replication via down regulation of the CDK inhibitor, p27 (Kip1).
21269460 2011 Initial characterization of the human central proteome.
21242974 2011 Methylation by protein arginine methyltransferase 1 increases stability of Axin, a negative regulator of Wnt signaling.
21238544 2011 Effect of glycogen synthase kinase 3 ?-mediated presenilin 1 phosphorylation on amyloid ? production is negatively regulated by insulin receptor cleavage.
21228102 2011 GSK3? inactivation in podocytes results in decreased phosphorylation of p70S6K accompanied by cytoskeletal rearrangements and inhibited motility.
21217772 2011 Glycogen synthase kinase-3? is a crucial mediator of signal-induced RelB degradation.
21212533 2011 Glycogen synthase kinase-3?2 has lower phosphorylation activity to tau than glycogen synthase kinase-3?1.
21204008 2010 Progranulin promotes neurite outgrowth and neuronal differentiation by regulating GSK-3?.
21189258 2011 Inhibition of proinflammatory RANTES expression by TGF-beta1 is mediated by glycogen synthase kinase-3beta-dependent beta-catenin signaling.
21179545 2010 GSK3 regulates mitotic chromosomal alignment through CRMP4.
21160051 2011 The role of glycogen synthase kinase 3 in regulating IFN-?-mediated IL-10 production.
21159074