Property Summary

NCBI Gene PubMed Count 111
PubMed Score 52.32
PubTator Score 143.91

Knowledge Summary

Patent (6,631)

Expression

Protein-protein Interaction (4)

MLP Assay (9)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
2650 screening 318 / 1 / 315189 Luminescence Cell-Free Homogenous Primary HTS to Identify Inhibitors of GSK-3 alpha
2709 summary 0 / 0 / 0 Summary of Broad Institute MLPCN Glycogen Synthase Kinase-3 alpha Project
463203 confirmatory 769 / 18 / 1565 Luminescence Cell-Free Homogeneous Dose Retest to Confirm Inhibitors of GSK-3 alpha
588361 confirmatory 15 / 1 / 0 Inhibition of Human GSK-3 alpha Activity Measured in Biochemical System Using Microfluidics - 2063-06_Inhibitor_Dose_DryPowder_Activity
588434 confirmatory 25 / 1 / 0 Inhibition of Human GSK-3 alpha Activity Measured in Biochemical System Using Microfluidics - 2063-06_Inhibitor_Dose_DryPowder_Activity_Set2
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
623978 confirmatory 18 / 3 / 3 Inhibition of Human GSK3 alpha Activity Measured in Biochemical System Using Microfluidics - 2046-11_Inhibitor_Dose_DryPowder_Activity_Set2
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (78)

PMID Text
27049759 demonstrated that GSK-3alpha is regulated by CREB in lung cancer and is required for the cell viability. These findings implicate CREB-GSK-3alpha axis as a novel therapeutic target for lung cancer treatment
26766591 reveals that GSK-3alpha- and GSK-3beta-regulated pathways can be responsible for stepwise transition to myelodysplastic syndromes and subsequent acute myeloid leukemia
26393419 GSK3 acts through APC motifs R2 and B to regulate APC:Axin interactions, promoting high-throughput of betacatenin to destruction.
25935310 CHP3 functions as a novel negative regulator of cardiomyocyte hypertrophy via inhibition of GSK3alpha/beta phosphorylation.
25561726 Data indicate that autophagy inhibition promotes glycogen synthase kinase-(GSK3) inhibition-induced apoptosis.
25550525 glycogen synthase kinase 3 alpha and beta activity is increased in foetal membranes after term and preterm labour
25486534 Elevated GSK3 protein kinase activity is associated with non-small cell lung carcinoma
25187516 PtpA has a role in promoting anti-apoptotic activity of protein-dependent dephosphorylation of host GSK3alpha
25183803 ER stress-PERK-GSK3alpha/beta signaling promotes proatherogenic macrophage lipid accumulation
24984063 GSK3A is redundant with GSK3B in regulating drug-resistance and chemotherapy-induced necroptosis
24803542 In lipopolysaccharide-stimulated human neutrophils, GSK-3-alpha inhibitors mimicked the effect of LiCl, by potentiating TNF-alpha release after 4 h. GSK-3 inhibition prolongs activation of the p38/MNK1/eIF4E pathway of mRNA translation.
24685987 Protein Kinase B-dependent phosphorylation of glycogen synthase kinase GSK-3 contributes to the pro-fibrotic signaling leading to renal tissue fibrosis in obstructive nephropathy
24675460 TRAIL-induced apoptosis in pancreatic ductal adenocarcinoma cell lines is enhanced by pharmacological inhibition of glycogen synthase kinase-3 (GSK-3) or by shRNA-mediated depletion of either GSK-3alpha or GSK-3beta.
24254703 This review highlights the emerging role of GSK3alpha in Alzheimer's disease which has been largely overlooked in favor of GSK3beta.
24060635 JNK and GSK3 especially are potential signaling molecules regulating BMP-induced osteoblastic human mesenchymal stem cells differentiation.
24035907 GSK-3 expression and regulation in human neutrophils, was investigated.
23896637 this studydemonstrated abundant levels of the critical negative cell-cycle regulators, p27(Kip1), its phosphorylated form, p-p27(S10), p18Ink4c, and GSK-3, in beta-cells of both adult human and mouse pancreatic islets, which contribute to maintenance of beta-cell quiescence.
23798682 GSK3alpha, GSK3beta, and MAPK13 were found to be the most active tau kinases, phosphorylating tau at all four epitopes.
23621307 The involvement of GSK-3 in several key pathophysiological pathways leading to AD and neurodegenerative diseases has placed this enzyme in a central position in this disorder.
23369789 Studies indicate the therapeutic potential of GSK-3 inhibitors for treatment of neurodegenerative and behavior disorders.
23352529 GSK-3 may play a crucial role in the inflammatory process in chronic rhinosinusitis with nasal polyps (CRSwNP).
23243017 Findings suggest that inhibiton of Bcl-2, Bcl-xL and PI3K, and release of Bim from Bcl-2/Bcl-xL and GSK3alpha/beta culminating in Bax/Bak activation and apoptosis.
23192081 Activation of GABA(B) receptors significantly inhibits Akt/GSK-3 signaling in a beta-arrestin-dependent pathway.
22658458 Lower phosphorylation levels of GSK3A is associated with poor treatment response in rectal cancer.
22539723 glycogen synthase kinase-3 (GSK3), when deinhibited by default in cells deprived of growth factors, activates acetyltransferase TIP60 through phosphorylating TIP60-Ser86, which acetylates and stimulates the protein kinase ULK1, which is required for autophagy
22539113 GSK-3alpha is more prevalent in low Gleason score tumors, where it might promote androgen-dependent proliferation by activating androgen receptor.
22384031 GSK3 inhibitor-BIO regulates proliferation of immortalized pancreatic mesenchymal stem cells
22328534 investigated whether GSK-3 activity is regulated by thymosin beta-4 (Tbeta4) and associated with Tbeta4-mediated migration in gastric cancer cells; expression of GSK-3alpha, beta-catenin and E-cadherin could be negatively regulated by Tbeta4 induced ERK phosphorylation; suggests that Tbeta4 could be a novel regulator to control Wnt signal pathway
22326953 GSK-3alpha has a role and is a target in human acute myeloid leukemia
22065737 Glycogen synthase kinase (GSK)-3 promotes p70 ribosomal protein S6 kinase (p70S6K) activity and cell proliferation.
21896753 Data show that p53 directly up-regulates microRNA-149* (miR-149*) that in turn targets glycogen synthase kinase-3alpha, resulting in increased expression of Mcl-1 and resistance to apoptosis in melanoma cells.
21576335 The authors demonstrate that inhibition of GSK-3 dampens Bacillus anthracis edema toxin-induced maturation and migration processes of monocyte-derived dendritic cells.
21436692 Overexpression of glycogen synthase kinase-3 alpha in ovarian carcinoma cells is associated with acquired paclitaxel resistance.
21320285 GSK3 acts as a molecular brake on the signaling pathway, leading to TF expression in monocytes interacting with activated platelets
21255011 Data show that the effects of PI3K-Akt signalling on IL-10 responses were mediated at least in part by GSK3.
20920357 in multiple myeloma cells GSK-3alpha and beta play distinct roles in cell survival and modulate the sensitivity to proteasome inhibitors
20831597 Phosphorylation of proteins in the brain associated with Alzheimer's disease is altered in cortical tissue lacking transgenic glycogen synthase kinase-3alpha and -3ss.
20668436 Investigations with human tissues in this review strongly support the postulate that GSK3 has a pathological role in mood disorders and is likely a therapeutic target in mood disorder treatment.
20541704 GSK-3 maintains the MLL leukemia stem cell transcriptional program by promoting the conditional association of CREB and its coactivators TORC and CBP with homedomain protein MEIS1, which in turn facilitates HOX-mediated transcription and transformation.
20371704 Glycogen synthase kinase (GSK3) plays a central role in promoting glucocorticoid-induced apoptosis.
20368287 Data identify DEAF1 as an interactor and in vitro substrate of GSK3A and GSK3B that interacts with the phosphatidylinositol 3-kinase-mammalian target of rapamycin pathway.
20113358 Observational study of gene-disease association. (HuGE Navigator)
20080974 the N termini of both GSK-3 isoforms were dispensable, whereas progressive C-terminal deletions resulted in protein misfolding exhibited by deficient activity, impaired ability to interact with Axin, and a loss of Tyr(279/216) phosphorylation
19706605 GSK-3 interacts with and phosphorylates delta-catenin and thereby negatively affects its stability by enabling its ubiquitination/proteosome-mediated proteolysis
19705135 widely expressed throughout the hair follicles
19656851 Studies show that GSK-3 and Omi/HtrA2 synergistically cause annexin A2 cleavage and then cell cycle inhibition or apoptosis.
19507191 Constitutive basal activity of PKR is required for leukemic cell homeostasis and growth and functions as a negative regulator of AKT, thereby increasing the pool of potentially active GSK-3.
19464003 study suggests that downstream signaling components of the PI3K/Akt pathway, GSK3 & cyclin D2 as well as the significant interaction between PTEN-PDK and between pAkt-pGSK3beta, are involved in the survival and proliferation of leiomyomas.
19336475 Observational study of gene-disease association. (HuGE Navigator)
19323791 immunoreactivity of IGF-I and GSK3a/b signaling pathways studied in ALS spinal cords and hippocampus with special reference to Kii and Guam ALS patients: in Japanese ALS patients, IGF-I expression was positively correlated with the clinical duration.
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19142874 Results describe a novel function of chaperonin 10 as a general differentiation factor, not limited to erythroid cells, and show how this biological effect is mediated by GSK-3alpha/beta.
19136008 The authors found that threonine 10 of H1.5 can be phosphorylated by glycogen synthase kinase-3 in vitro
18955053 This review concentrates on the role of protein kinase glycogen synthase kinase 3 in the different types of Alzheimers' disease.
18829575 GSK-3 and IKK as potential therapeutic targets for pancreatic cancer.
18826950 Incubation of human macrophages with exogenous HIV-1 Nef protein induces phosphorylation of Akt and GSK-3ss, and promotes IL-10 release
18516299 inhibition of glycogen synthase kinase-3 in androgen-responsive prostate cancer cell lines may reduce AR transcriptional activity and AR protein levels
18500637 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18450971 Activin A may mediate ovarian oncogenesis by activating Akt and repressing GSK to stimulate cellular proliferation.
18042454 Maf-transforming activity is controlled by GSK-3-dependent phosphorylation and that phosphorylation by GSK-3 can increase the oncogenic activity of a protein.
17609434 GSK-3 is required for E2-induced ERalpha phosphorylation at Ser-118 and full transcriptional activity of the receptor upon E2 stimulation.
17569761 Reduction of GSK3alpha expression results in improvements in insulin action and elevation of GSK3alpha in human skeletal muscle cells can induce insulin resistance for several responses
17325032 direct regulation of hypoxia-inducible factor 1 alpha subunit stability by GSK-3 may influence physiological processes or pathophysiological situations such as metabolic diseases or tumors
17158447 Glycogen synthase kinase 3alpha (GSK-3alpha) is identified as a partner for Cdc42 GTPase-activating protein (CdGAP).
17052453 S6K1 regulates GSK3 under conditions of mTOR-dependent feedback inhibition of Akt
16987514 These results indicate that the protein phosphatase-1/inhibitor-2 complex differentially regulates GSK3 dephosphorylation induced by KCl and that GSK3 activity regulates SERCA2 levels.
16984735 NT uses PKC-dependent pathways to modulate GSK-3, which may play a role in the NT regulation of intestinal cell growth
16934436 These results suggest i) an essential role of PI3K/Akt/GSK-3alpha/beta signaling for a successful replication of VZV and ii) a key function of VZV kinases pORFs 47 and 66 to activate this pathway.
16912034 analysis of critical variations in the function and regulation of GSK-3alpha and GSK-3beta
16806170 Induction of keratinocyte migration is conveyed through EGFR, promoted by endogenous HB-EGF and requires GSK-3alpha activity.
16757548 there is tissue specificity for the regulation of GSK-3 in humans; in skeletal muscle GSK-3 plays a role in control of metabolism and insulin action, whereas the function in adipose tissue is less clear
16611631 GSK3 alters phosphorylation of CRMP-1, -2, and -4 isoforms
16543145 The results demonstrate that the control of MCL-1 stability by GSK-3 is an important mechanism for the regulation of apoptosis by growth factors, PI3K, and AKT.
15631989 Data show that the activity of glycogen synthase kinase-3 (GSK-3) is necessary for the maintenance of the epithelial architecture, and that GSK-3 inhibition stimulates the transcription of Snail
15194499 Data show that myotubes defective in glycogen synthase (GS) activity express insulin-responsive glycogen synthase kinase-3alpha, suggesting that failure of insulin to decrease GS phosphorylation involves abnormal activity of another kinase or phosphatase.
14550568 GSK3alpha is a potential regulator of platelet function
12761548 Paper shows that GSK-3 isoforms are not functionally equivalent in regulating the production of Abeta peptides. siRNA used to knockdown endogenous GSK-3 isoforms in cultured cells.
12086949 improves insulin action and glucose metabolism in skeletal muscle

AA Sequence

MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPG      1 - 70
GSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAE     71 - 140
TRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFT    141 - 210
KAKLTIPILYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYI    211 - 280
CSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPN    281 - 350
YTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLP    351 - 420
PLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLTNSS           421 - 483
//

Text Mined References (123)

PMID Year Title
27049759 2016 GSK-3? Is a Novel Target of CREB and CREB-GSK-3? Signaling Participates in Cell Viability in Lung Cancer.
26766591 2016 GSK3 Deficiencies in Hematopoietic Stem Cells Initiate Pre-neoplastic State that Is Predictive of Clinical Outcomes of Human Acute Leukemia.
26393419 2015 A novel GSK3-regulated APC:Axin interaction regulates Wnt signaling by driving a catalytic cycle of efficient ?catenin destruction.
25935310 2015 Calcineurin B homologous protein 3 negatively regulates cardiomyocyte hypertrophy via inhibition of glycogen synthase kinase 3 phosphorylation.
25561726 2015 Glycogen synthase kinase-3 (GSK3) inhibition induces prosurvival autophagic signals in human pancreatic cancer cells.
25550525 2015 A novel role for GSK3 in the regulation of the processes of human labour.
25486534 2014 Glycogen synthase kinase 3 protein kinase activity is frequently elevated in human non-small cell lung carcinoma and supports tumour cell proliferation.
25187516 2014 Mycobacterium tuberculosis promotes anti-apoptotic activity of the macrophage by PtpA protein-dependent dephosphorylation of host GSK3?.
25183803 2014 Protein kinase R-like endoplasmic reticulum kinase and glycogen synthase kinase-3?/? regulate foam cell formation.
24984063 2014 GSK3A is redundant with GSK3B in modulating drug resistance and chemotherapy-induced necroptosis.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
24803542 2014 TNF-? expression in neutrophils and its regulation by glycogen synthase kinase-3: a potentiating role for lithium.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24685987 2013 PKB/SGK-resistant GSK-3 signaling following unilateral ureteral obstruction.
24675460 2014 Differential activity of GSK-3 isoforms regulates NF-?B and TRAIL- or TNF? induced apoptosis in pancreatic cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24254703 2014 GSK3 in Alzheimer's disease: mind the isoforms.
24060635 2014 Crosstalk between tyrosine kinase receptors, GSK3 and BMP2 signaling during osteoblastic differentiation of human mesenchymal stem cells.
24035907 2013 Expression and regulation of glycogen synthase kinase 3 in human neutrophils.
23896637 The negative cell cycle regulators, p27(Kip1), p18(Ink4c), and GSK-3, play critical role in maintaining quiescence of adult human pancreatic ?-cells and restrict their ability to proliferate.
23798682 2013 An unbiased approach to identifying tau kinases that phosphorylate tau at sites associated with Alzheimer disease.
23621307 2013 Understanding the relationship between GSK-3 and Alzheimer's disease: a focus on how GSK-3 can modulate synaptic plasticity processes.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23369789 2013 GSK-3 inhibition: achieving moderate efficacy with high selectivity.
23352529 2013 Glycogen synthase kinase 3 in chronic rhinosinusitis: two faces of a single enzyme in one disease.
23243017 2013 Dual inhibition of Bcl-2 and Bcl-xL strikingly enhances PI3K inhibition-induced apoptosis in human myeloid leukemia cells through a GSK3- and Bim-dependent mechanism.
23192081 2012 Activation of GABA(B) receptors inhibits protein kinase B/glycogen synthase kinase 3 signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22658458 2012 Multiplexed protein signal pathway mapping identifies patients with rectal cancer that responds to neoadjuvant treatment.
22539723 2012 GSK3-TIP60-ULK1 signaling pathway links growth factor deprivation to autophagy.
22539113 2012 Distinct expression and activity of GSK-3? and GSK-3? in prostate cancer.
22384031 2012 GSK3 inhibitor-BIO regulates proliferation of immortalized pancreatic mesenchymal stem cells (iPMSCs).
22328534 2012 Regulation of glycogen synthase kinase-3 by thymosin beta-4 is associated with gastric cancer cell migration.
22326953 2012 The intersection of genetic and chemical genomic screens identifies GSK-3? as a target in human acute myeloid leukemia.
22065737 2011 Glycogen synthase kinase (GSK)-3 promotes p70 ribosomal protein S6 kinase (p70S6K) activity and cell proliferation.
21896753 2011 MicroRNA-149*, a p53-responsive microRNA, functions as an oncogenic regulator in human melanoma.
21711983 2012 A role for Akt and glycogen synthase kinase-3 as integrators of dopamine and serotonin neurotransmission in mental health.
21576335 2011 Glycogen synthase kinase 3 activation is important for anthrax edema toxin-induced dendritic cell maturation and anthrax toxin receptor 2 expression in macrophages.
21436692 2011 Overexpression of glycogen synthase kinase-3 in ovarian carcinoma cells with acquired paclitaxel resistance.
21320285 2011 Glycogen synthase kinase-3 negatively regulates tissue factor expression in monocytes interacting with activated platelets.
21269460 2011 Initial characterization of the human central proteome.
21255011 2011 Interleukin-10-induced gene expression and suppressive function are selectively modulated by the PI3K-Akt-GSK3 pathway.
20920357 2010 Glycogen Synthase Kinase-3 regulates multiple myeloma cell growth and bortezomib-induced cell death.
20831597 2010 Evidence that glycogen synthase kinase-3 isoforms have distinct substrate preference in the brain.
20668436 2010 Is glycogen synthase kinase-3 a central modulator in mood regulation?
20541704 2010 GSK-3 promotes conditional association of CREB and its coactivators with MEIS1 to facilitate HOX-mediated transcription and oncogenesis.
20371704 2010 Glycogen synthase kinase-3 plays a central role in mediating glucocorticoid-induced apoptosis.
20368287 2010 Interactome mapping of the phosphatidylinositol 3-kinase-mammalian target of rapamycin pathway identifies deformed epidermal autoregulatory factor-1 as a new glycogen synthase kinase-3 interactor.
20113358 2010 Temporal lobe grey matter volume in schizophrenia is associated with a genetic polymorphism influencing glycogen synthase kinase 3-? activity.
20080974 2010 A noncatalytic domain of glycogen synthase kinase-3 (GSK-3) is essential for activity.
19759537 2009 Tankyrase inhibition stabilizes axin and antagonizes Wnt signalling.
19706605 2009 GSK-3 phosphorylates delta-catenin and negatively regulates its stability via ubiquitination/proteosome-mediated proteolysis.
19705135 2010 Expression and function of glycogen synthase kinase-3 in human hair follicles.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19656851 2009 Glycogen synthase kinase-3 and Omi/HtrA2 induce annexin A2 cleavage followed by cell cycle inhibition and apoptosis.
19507191 2009 PKR activity is required for acute leukemic cell maintenance and growth: a role for PKR-mediated phosphatase activity to regulate GSK-3 phosphorylation.
19464003 2010 Changes related to phosphatidylinositol 3-kinase/Akt signaling in leiomyomas: possible involvement of glycogen synthase kinase 3alpha and cyclin D2 in the pathophysiology.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19366350 2009 Glycogen synthase kinase 3: more than a namesake.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19323791 2009 Immunohistochemical expression of IGF-I and GSK in the spinal cord of Kii and Guamanian ALS patients.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19142874 2009 Chaperonin 10 as an endothelial-derived differentiation factor: role of glycogen synthase kinase-3.
19136008 2009 M phase-specific phosphorylation of histone H1.5 at threonine 10 by GSK-3.
18955053 2008 The role of glycogen synthase kinase 3 in the early stages of Alzheimers' disease.
18829575 2008 Maintenance of constitutive IkappaB kinase activity by glycogen synthase kinase-3alpha/beta in pancreatic cancer.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18516299 2008 Inhibition of glycogen synthase kinase-3 in androgen-responsive prostate cancer cell lines: are GSK inhibitors therapeutically useful?
18500637 2008 Association study of GSK3 gene polymorphisms with schizophrenia and clozapine response.
18450971 2008 The role of activin A and Akt/GSK signaling in ovarian tumor biology.
18285345 2008 Phosphorylation of Ser357 of rat insulin receptor substrate-1 mediates adverse effects of protein kinase C-delta on insulin action in skeletal muscle cells.
18042454 2007 GSK-3-mediated phosphorylation enhances Maf-transforming activity.
17609434 2007 Glycogen synthase kinase-3 protects estrogen receptor alpha from proteasomal degradation and is required for full transcriptional activity of the receptor.
17569761 2007 Role of glycogen synthase kinase-3 alpha in insulin action in cultured human skeletal muscle cells.
17510365 2007 Wilms tumor suppressor WTX negatively regulates WNT/beta-catenin signaling.
17478001 2007 The role of GSK3 in glucose homeostasis and the development of insulin resistance.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17325032 2007 Glycogen synthase kinase 3 phosphorylates hypoxia-inducible factor 1alpha and mediates its destabilization in a VHL-independent manner.
17318175 2007 Protein phosphatase 1 regulates assembly and function of the beta-catenin degradation complex.
17229088 2006 GSK3alpha exhibits beta-catenin and tau directed kinase activities that are modulated by Wnt.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
17158447 2007 Glycogen synthase kinase-3 phosphorylates CdGAP at a consensus ERK 1 regulatory site.
17052453 2006 S6K1 regulates GSK3 under conditions of mTOR-dependent feedback inhibition of Akt.
16987514 2006 The protein phosphatase-1/inhibitor-2 complex differentially regulates GSK3 dephosphorylation and increases sarcoplasmic/endoplasmic reticulum calcium ATPase 2 levels.
16984735 2006 Neurotensin phosphorylates GSK-3alpha/beta through the activation of PKC in human colon cancer cells.
16934436 2007 Varicella-zoster virus requires a functional PI3K/Akt/GSK-3alpha/beta signaling cascade for efficient replication.
16912034 2006 Differential roles of glycogen synthase kinase-3 isoforms in the regulation of transcriptional activation.
16806170 2006 HaCaT keratinocyte migration is dependent on epidermal growth factor receptor signaling and glycogen synthase kinase-3alpha.
16757548 2006 Tissue-specific expression and regulation of GSK-3 in human skeletal muscle and adipose tissue.
16611631 2006 Distinct priming kinases contribute to differential regulation of collapsin response mediator proteins by glycogen synthase kinase-3 in vivo.
16543145 2006 Glycogen synthase kinase-3 regulates mitochondrial outer membrane permeabilization and apoptosis by destabilization of MCL-1.
16446437 2006 Abeta and tau form soluble complexes that may promote self aggregation of both into the insoluble forms observed in Alzheimer's disease.
16365045 2006 The low density lipoprotein receptor-related protein 6 interacts with glycogen synthase kinase 3 and attenuates activity.
15631989 2005 Glycogen synthase kinase-3 is an endogenous inhibitor of Snail transcription: implications for the epithelial-mesenchymal transition.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15194499 2004 The primary defect in glycogen synthase activity is not based on increased glycogen synthase kinase-3alpha activity in diabetic myotubes.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14550568 2003 Regulation of glycogen synthase kinase 3 in human platelets: a possible role in platelet function?
12890758 2003 Glycogen synthase kinase-3 regulates formation of long lamellipodia in human keratinocytes.
12761548 2003 GSK-3alpha regulates production of Alzheimer's disease amyloid-beta peptides.
12675919 2003 Protein kinase and protein phosphatase expression in amyotrophic lateral sclerosis spinal cord.
12665592 2003 Phosphorylation of serine 303 is a prerequisite for the stress-inducible SUMO modification of heat shock factor 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12379450 2002 GSK-3 parameters in lymphocytes of schizophrenic patients.
12086949 2002 Inhibition of glycogen synthase kinase 3 improves insulin action and glucose metabolism in human skeletal muscle.
12054501 2002 Human serum and glucocorticoid-inducible kinase-like kinase (SGKL) phosphorylates glycogen syntheses kinase 3 beta (GSK-3beta) at serine-9 through direct interaction.
11884598 2002 Convergence of multiple signaling cascades at glycogen synthase kinase 3: Edg receptor-mediated phosphorylation and inactivation by lysophosphatidic acid through a protein kinase C-dependent intracellular pathway.
11749387 2001 Glycogen synthase kinase-3: properties, functions, and regulation.
11500362 2001 Eukaryotic initiation factor 2B: identification of multiple phosphorylation sites in the epsilon-subunit and their functions in vivo.
11035810 2000 Phosphorylation and inactivation of glycogen synthase kinase 3 by protein kinase A.
10868943 2000 Potential role of glycogen synthase kinase-3 in skeletal muscle insulin resistance of type 2 diabetes.
10448973 1999 Expression analysis of glycogen synthase kinase-3 in human tissues.
9809441 1998 Isolation and chromosomal mapping of human glycogen synthase kinase-3 alpha and -3 beta encoding genes.
8725894 Glycogen synthase kinase 3 alpha and 3 beta do not colocalize with neurofibrillary tangles.
8524413 1995 Inhibition of glycogen synthase kinase-3 by insulin mediated by protein kinase B.
7931292 1994 Protein kinase FA/glycogen synthase kinase-3 alpha after heparin potentiation phosphorylates tau on sites abnormally phosphorylated in Alzheimer's disease brain.
7715701 1995 Glycogen synthase kinase-3 and dorsoventral patterning in Xenopus embryos.