Property Summary

NCBI Gene PubMed Count 19
PubMed Score 23.95
PubTator Score 7.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Hay fever 10
Disease Target Count P-value
psoriasis 6685 1.8e-43
Disease Target Count Z-score Confidence
Asthma 349 3.597 1.8
Hemolytic anemia 70 0.0 2.0
Disease Target Count Z-score Confidence
Alopecia 55 3.621 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 1.8e-43

Synonym

Accession Q96QA5 Q32MC5 Q86VE7 Q8N1M6
Symbols GSDM
FKSG9
GSDM1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

PMID Text
26484354 Based on our results and published findings on GSDMA, GSDMB, LRRC3C, and related proteins, we propose that this locus in part affects IBD susceptibility via effects on apoptosis and cell proliferation
22037903 Study identified significantly white blood cell count (WBC) level associated SNPs of three separate genes GSDMA, MED24, and PSMD3 in European continent (EA) subjects.
21546069 Results suggest an association of 17q21 polymorphisms with ORMDL3, GSDMA expression, and IL-17 secretion early in life. These observations may imply a functional role of the 17q21 locus affecting T-cell development during immune maturation.
21337730 The GSDMA (rs7212938) and GSDMB (rs7216389) polymorphisms are associated with asthma susceptibility and intermediate asthma phenotypes.
19051310 Study investigated the expression pattern of the GSDM family genes in the upper gastrointestinal epithelium and cancers.
17471240 The present data suggest that TGF-beta, LMO1, possibly RUNX3, and GSDM form a regulatory pathway for directing the pit cells to apoptosis.
15010812 Evolutionary recombination hotspot around the GSDML-GSDM locus is closely linked to oncogenomic recombination hotspot around the PPP1R1B-STARD3-TCAP-PNMT-PERLD1-ERBB2-C17orf37-GRB7 amplicon at human chromosome 17q12.

AA Sequence

MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSP      1 - 70
SDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETVQERKLAADHPFL     71 - 140
KEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFFAPLGLQGSINHKEAVTIPKGCVLAFRVRQL    141 - 210
MVKGKDEWDIPHICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVEKLSRVGQS    211 - 280
SLLSSLSKLLGKKKELQDLELALEGALDKGHEVTLEALPKDVLLSKEAVGAILYFVGALTELSEAQQKLL    281 - 350
VKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMW    351 - 420
DPDTLPRLCALYAGLSLLQQLTKAS                                                 421 - 445
//

Text Mined References (23)

PMID Year Title
27281216 2016 Pore-forming activity and structural autoinhibition of the gasdermin family.
26484354 2015 Gene Expression-Genotype Analysis Implicates GSDMA, GSDMB, and LRRC3C as Contributors to Inflammatory Bowel Disease Susceptibility.
24388013 2014 Genome-wide association analysis identifies 11 risk variants associated with the asthma with hay fever phenotype.
24241537 2014 A genome-wide association study identifies CDHR3 as a susceptibility locus for early childhood asthma with severe exacerbations.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22037903 2012 Genetic variants associated with the white blood cell count in 13,923 subjects in the eMERGE Network.
21738480 2011 Multiple loci are associated with white blood cell phenotypes.
21546069 2011 Asthma-associated polymorphisms in 17q21 influence cord blood ORMDL3 and GSDMA gene expression and IL-17 secretion.
21337730 2011 Polymorphisms in GSDMA and GSDMB are associated with asthma susceptibility, atopy and BHR.
20860503 2010 A large-scale, consortium-based genomewide association study of asthma.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19820697 2009 A genome-wide meta-analysis identifies 22 loci associated with eight hematological parameters in the HaemGen consortium.
19051310 2009 Distinctive expression and function of four GSDM family genes (GSDMA-D) in normal and malignant upper gastrointestinal epithelium.
17471240 2007 GASDERMIN, suppressed frequently in gastric cancer, is a target of LMO1 in TGF-beta-dependent apoptotic signalling.
17350798 2007 Members of a novel gene family, Gsdm, are expressed exclusively in the epithelium of the skin and gastrointestinal tract in a highly tissue-specific manner.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15010812 2004 Evolutionary recombination hotspot around GSDML-GSDM locus is closely linked to the oncogenomic recombination hotspot around the PPP1R1B-ERBB2-GRB7 amplicon.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12883658 2003 Identification and characterization of human ZPBP-like gene in silico.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10967128 2000 Gasdermin (Gsdm) localizing to mouse Chromosome 11 is predominantly expressed in upper gastrointestinal tract but significantly suppressed in human gastric cancer cells.