Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.29
PubTator Score 19.16

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (2)

Gene RIF (11)

PMID Text
25343336 GSC is also a prognostic factor for poor survival and metastasis of HCC, which suggests its potential as a therapeutic target for metastatic HCC.
24858567 Results suggest that GSC is the most potential biomarker of drug response and poor prognosis in ovarian serous carcinomas.
24290375 SAMS, a syndrome of short stature, auditory-canal atresia, mandibular hypoplasia, and skeletal abnormalities is a unique neurocristopathy caused by mutations in Goosecoid.
23378141 EtOH exposure increased the expression of an organizer specific gene, goosecoid, in human embryonic carcinoma cells.
22178155 GSC represses EVX1 expression and is required for development of anterior primitive-streak-like cell progeny in response to activin.
21294870 the 4 recently reported SNPs,located near BNC2, SORCS1, GSC and WDR72 loci, affecting glycemic control in type 1 diabetes had no apparent effect on HbA1c in type 2 diabetes; but, for SORCS1 SNP, findings do not rule out possible relationship with HbA1c
20195123 The goosecoid gene mutation in exon 3 may be involved in the malformation events (microtia) in this family.
19935299 Observational study of gene-disease association. (HuGE Navigator)
19875614 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18074379 GSC protein might contribute to the observed phenotype.
17142318 Goosecoid promotes tumor cell malignancy and suggest that other conserved organizer genes may function similarly in human cancer

AA Sequence

MPASMFSIDNILAARPRCKDSVLPVAHSAAAPVVFPALHGDSLYGASGGASSDYGAFYPRPVAPGGAGLP      1 - 70
AAVSGSRLGYNNYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMN     71 - 140
VGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKN    141 - 210
RRAKWRRQKRSSSEESENAEKWNKTSSSKASPEKREEEGKSDLDSDS                           211 - 257
//

Text Mined References (18)

PMID Year Title
25343336 2014 Goosecoid promotes the metastasis of hepatocellular carcinoma by modulating the epithelial-mesenchymal transition.
24858567 2014 Overexpression of goosecoid homeobox is associated with chemoresistance and poor prognosis in ovarian carcinoma.
24290375 2013 SAMS, a syndrome of short stature, auditory-canal atresia, mandibular hypoplasia, and skeletal abnormalities is a unique neurocristopathy caused by mutations in Goosecoid.
23378141 2014 Chronic ethanol exposure increases goosecoid (GSC) expression in human embryonic carcinoma cell differentiation.
22178155 2012 EVEN-SKIPPED HOMEOBOX 1 controls human ES cell differentiation by directly repressing GOOSECOID expression.
21294870 2011 Evaluation of four novel genetic variants affecting hemoglobin A1c levels in a population-based type 2 diabetes cohort (the HUNT2 study).
20195123 2010 Pedigree and genetic study of a bilateral congenital microtia family.
19935299 2009 Environmental and genetic factors associated with congenital microtia: a case-control study in Jiangsu, China, 2004 to 2007.
19875614 2010 A genome-wide association study identifies a novel major locus for glycemic control in type 1 diabetes, as measured by both A1C and glucose.
18074379 2008 A child with deletion (14)(q24.3q32.13) and auditory neuropathy.
17142318 2006 The Spemann organizer gene, Goosecoid, promotes tumor metastasis.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15014966 2004 Sequence organization and matrix attachment regions of the human serine protease inhibitor gene cluster at 14q32.1.
12642491 2003 Joint regulation of the MAP1B promoter by HNF3beta/Foxa2 and Engrailed is the result of a highly conserved mechanism for direct interaction of homeoproteins and Fox transcription factors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9417125 1998 Negative autoregulation of the organizer-specific homeobox gene goosecoid.
7916327 1994 Molecular cloning of the human homeobox gene goosecoid (GSC) and mapping of the gene to human chromosome 14q32.1.