Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.09
PubTator Score 5.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
DEAFNESS, AUTOSOMAL RECESSIVE 25 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 1.1
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 4.616 2.3

Gene RIF (2)

AA Sequence

MLKREMKPESDRPRKVRFRIASSHSGRVLKEVYEDGQPSGSLDSECASICGIDGLGDSDGQQNGHIESEG      1 - 70
DENENDQDSLLVLARAASEKGFGTRRVNILSKNGTVRGVKYKVSAGQALFNNLTKVLQQPSTDLEFDRVV     71 - 140
IYTTCLRVVRTTFERCELVRKIFQNHRVKFEEKNIALNGEYGKELDERCRRVSEAPSLPVVFIDGHYLGG    141 - 210
AEKILSMNESGELQDILTKIERVQHPHECPSCGGFGFLPCSVCHGSKMSMFRNCFTDSFKALKCTACNEN    211 - 280
GLQRCKNCAG                                                                281 - 290
//

Text Mined References (9)

PMID Year Title