Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.68
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Adenocarcinoma of lung 142 0.0 0.0
Disease Models, Animal 155 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

Gene RIF (2)

AA Sequence

MAARKGRRRTCETGEPMEAESGDTSSEGPAQVYLPGRGPPLREGEELVMDEEAYVLYHRAQTGAPCLSFD      1 - 70
IVRDHLGDNRTELPLTLYLCAGTQAESAQSNRLMMLRMHNLHGTKPPPSEGSDEEEEEEDEEDEEERKPQ     71 - 140
LELAMVPHYGGINRVRVSWLGEEPVAGVWSEKGQVEVFALRRLLQVVEEPQALAAFLRDEQAQMKPIFSF    141 - 210
AGHMGEGFALDWSPRVTGRLLTGDCQKNIHLWTPTDGGSWHVDQRPFVGHTRSVEDLQWSPTENTVFASC    211 - 280
SADASIRIWDIRAAPSKACMLTTATAHDGDVNVISWSRREPFLLSGGDDGALKIWDLRQFKSGSPVATFK    281 - 350
QHVAPVTSVEWHPQDSGVFAASGADHQITQWDLAVERDPEAGDVEADPGLADLPQQLLFVHQGETELKEL    351 - 420
HWHPQCPGLLVSTALSGFTIFRTISV                                                421 - 446
//

Text Mined References (26)

PMID Year Title