Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.68
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Adenocarcinoma of lung 140 0.0 0.0
Disease Models, Animal 148 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6

Expression

Synonym

Accession Q9BQ67 A0MNN5 Q8TF59
Symbols CDW4
GRWD
RRB1
WDR28

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAARKGRRRTCETGEPMEAESGDTSSEGPAQVYLPGRGPPLREGEELVMDEEAYVLYHRAQTGAPCLSFD      1 - 70
IVRDHLGDNRTELPLTLYLCAGTQAESAQSNRLMMLRMHNLHGTKPPPSEGSDEEEEEEDEEDEEERKPQ     71 - 140
LELAMVPHYGGINRVRVSWLGEEPVAGVWSEKGQVEVFALRRLLQVVEEPQALAAFLRDEQAQMKPIFSF    141 - 210
AGHMGEGFALDWSPRVTGRLLTGDCQKNIHLWTPTDGGSWHVDQRPFVGHTRSVEDLQWSPTENTVFASC    211 - 280
SADASIRIWDIRAAPSKACMLTTATAHDGDVNVISWSRREPFLLSGGDDGALKIWDLRQFKSGSPVATFK    281 - 350
QHVAPVTSVEWHPQDSGVFAASGADHQITQWDLAVERDPEAGDVEADPGLADLPQQLLFVHQGETELKEL    351 - 420
HWHPQCPGLLVSTALSGFTIFRTISV                                                421 - 446
//

Text Mined References (26)

PMID Year Title