Property Summary

NCBI Gene PubMed Count 58
PubMed Score 248.30
PubTator Score 234.60

Knowledge Summary

Patent (11,079)

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8491 1.9e-11
Breast cancer 3098 1.8e-07
osteosarcoma 7933 3.4e-07
psoriasis 6685 2.4e-04
medulloblastoma, large-cell 6234 3.0e-04
Disease Target Count Z-score Confidence
Cancer 2346 4.534 2.3

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.500 2.4e-04
osteosarcoma 2.204 3.4e-07
medulloblastoma, large-cell 1.100 3.0e-04
ovarian cancer 1.300 1.9e-11
Breast cancer -1.700 1.8e-07

Gene RIF (42)

PMID Text
25630799 GRP-R regulates glucose metabolism in neuroblastoma by modulating HIF-1alpha, PDK4 and PDP2.
24958816 a key mechanism for GRPR-regulated colon cancer cell migration through the Galpha13-PRG-RhoA-ROCK pathway.
24912045 No association of 16 GRP and 7 GRPR variants were found with agoraphobia with/without panic disorder.
24747971 BBS caused a significant increase in Shh gene transcription and protein secretion that was dependent on BBS-induced GPCR/Galphaq-//Rho mediated activation of nuclear factor kappaB (NFkappaB), which can stimulate a NF-kappaB response element in the Shh gene promoter
24377816 GRPR expression was more pronounced in an advanced-stage lung cancer
23958544 GRPR is highly expressed in epidermoid carcinoma of the anal canal, suggesting this receptor might have a role in anal carcinogenesis.
23889963 integrin ss1 subunit critically regulates GRP-R-mediated neuroblastoma cell migration and invasion
23155231 Protein kinase C is critically responsible for rapid VEGF secretion by gastrin-releasing peptide receptor signaling in neuroblastoma cells
22735756 These findings highlight the role of GRPR signaling in sepsis outcome.
22431275 Elevated buccal GRPR espression was significantly associated with squamous cell carcinoma of the head and neck.
22411014 Tonic stretch of human myometrium increases contractility and stimulates the expression of a known smooth muscle stimulatory agonist, GRP. GRP receptor antagonists attenuate the effect of stretch.
22296774 Bronchial gastrin-releasing peptide receptor expression was significantly associated with lung cancer in a multivariable logistic regression model adjusted for age, sex, smoking status and pulmonary function. Lung cancer risk was not modified by sex.
22248281 High GRPR is associated with prostate carcinoma.
21605611 Concomitant vascular GRP-receptor and VEGF-receptor expression in human tumors provides molecular basis for dual targeting of tumoral vasculature.
20596631 GRP promotes the growth of HepG2 cells through interaction with GRPR co-expressed in tumor cells, and subsequently activates MAPK/ERK1/2 via EGFR-independent mechanisms.
20211708 This study is the first to confirm the presence of gastrin-releasing peptide receptor in human glioma specimens and normal human neurons.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19642024 The results suggest that brain-derived neurotrophic factor/TrkB and cAMP phosphodiesterase-4, but not the gastrin-releasing peptide receptor, regulate the viability of medulloblastoma cells.
19631337 In MDA-MB-231 breast cancer cells, GRP-R and EGF-R synergize to regulate cell migration and IL-8 expression, but not cell proliferation.
19478282 High expression of gastrin-releasing peptide receptors is associated with the vascular bed of urinary tract cancers.
19343734 Gastrin-releasing peptide receptor is expressed in the vast majority of lymph node metastases and in 52.9% of bone metastases of prostate cancer.
19204726 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18753628 These findings demonstrate that GRP and GRP-R have important oncogenic properties beyond their established mitogenic functions.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18663369 Observational study of gene-disease association. (HuGE Navigator)
18497507 Widespread GRPR expression in human cervical cancer.
18483184 CREB is a critical regulator of human GRP-R expression in gastrointestinal cancer and might be activated through different upstream intracellular pathways
18452185 genes encoding corticotropin releasing hormone receptor 1, tachykinin receptor 1, gastrin releasing peptide, and gastrin releasing peptide receptor were selected as candidates for PD based on their biology
18452185 Observational study of gene-disease association. (HuGE Navigator)
18393381 There is a potential role of C6S and L181F mutations on GRPR function, and possibly in the pathogenesis of the autistic disorders.
17726264 The large amounts of GRP-receptors in ovarian tumor vessels suggest a role in tumoral vasculature and possibly angiogenesis.
17349623 GRP appears to rescue NSCLC cells exposed to gefitinib through release of amphiregulin and activation of the Akt pathway, suggesting GRPR and/or EGFR autocrine pathways in NSCLC cells may modulate therapeutic response to EGFR inhibitors.
15967120 Gastrin-releasing peptide receptor mediates activation of the epidermal growth factor receptor in lung cancer cells
15941862 The expression of GRP-R in uterine tissue during specific phases of the cycle suggests a timely precise physiological action of GRP in these targets; in certain uterine neoplasms, the GRP-R overexpression may contribute to tumor development
14729406 Observational study of gene-disease association. (HuGE Navigator)
12771999 Increased gastrin-releasing peptide (GRP) receptor expression in small cell lung cancer cells confers sensitivity to [Arg6,D-Trp7,9,NmePhe8]-substance P (6-11)-induced growth inhibition
12720295 accumulation of mutations within the GRPR gene allows for the dedifferentiation of tumor cells within any particular colon cancer; poorly-differentiated tumor cells within any individual cancer may arise clonally from better-differentiated precursors
12474049 mRNA transcripts are expressed in tumor cells of patients with small cell lung cancer
12409226 Bombesin-dependent activation (through GRP receptor) of the transcription factor Elk-1 and significant increase of cell proliferation in prostate cancer cell lines
12220644 hGRP-R activation stimulated sustained cyclic AMP response element binding protein (CREB) phosphorylation and transactivation in duodenal cancer cells through a protein kinase C and partially p38 mitogen-activated protein kinase-dependent pathway.
11960700 GRP/GRP-R play a transient and non-critical role in intestinal development

AA Sequence

MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLIGNITLIKIFCTVKS      1 - 70
MRNVPNLFISSLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQLTSVGVSVFTLTALSADRYK     71 - 140
AIVRPMDIQASHALMKICLKAAFIWIISMLLAIPEAVFSDLHPFHEESTNQTFISCAPYPHSNELHPKIH    141 - 210
SMASFLVFYVIPLSIISVYYYFIAKNLIQSAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPN    211 - 280
HVIYLYRSYHYSEVDTSMLHFVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLIIRSHS    281 - 350
TGRSTTCMTSLKSTNPSVATFSLINGNICHERYV                                        351 - 384
//

Text Mined References (59)

PMID Year Title
25630799 2015 Silencing gastrin-releasing peptide receptor suppresses key regulators of aerobic glycolysis in neuroblastoma cells.
24958816 2014 G?13/PDZ-RhoGEF/RhoA signaling is essential for gastrin-releasing peptide receptor-mediated colon cancer cell migration.
24912045 2014 Analysis of gastrin-releasing peptide gene and gastrin-releasing peptide receptor gene in patients with agoraphobia.
24747971 2015 Cross talk between the bombesin neuropeptide receptor and Sonic hedgehog pathways in small cell lung carcinoma.
24377816 2014 Gastrin-releasing peptide receptor expression in lung cancer.
23958544 2014 Expression of gastrin-releasing peptide receptor in epidermoid carcinoma of the anal canal.
23889963 2013 Integrin ?1 is critical for gastrin-releasing peptide receptor-mediated neuroblastoma cell migration and invasion.
23155231 2012 Protein kinase C regulates bombesin-induced rapid VEGF secretion in neuroblastoma cells.
22735756 2012 Gastrin-releasing peptide receptor antagonism induces protection from lethal sepsis: involvement of toll-like receptor 4 signaling.
22431275 2013 Elevated gastrin-releasing peptide receptor mRNA expression in buccal mucosa: association with head and neck squamous cell carcinoma.
22411014 2012 Expression of gastrin-releasing peptide is increased by prolonged stretch of human myometrium, and antagonists of its receptor inhibit contractility.
22296774 2012 Gastrin-releasing peptide receptor expression in non-cancerous bronchial epithelia is associated with lung cancer: a case-control study.
22248281 2012 Immunohistochemical analysis of gastrin-releasing peptide receptor (GRPR) and possible regulation by estrogen receptor ?cx in human prostate carcinoma.
21605611 2011 Concomitant vascular GRP-receptor and VEGF-receptor expression in human tumors: molecular basis for dual targeting of tumoral vasculature.
20596631 2010 Gastrin-releasing peptide promotes the growth of HepG2 cells via EGFR-independent ERK1/2 activation.
20211708 2010 Gastrin-releasing peptide receptor content in human glioma and normal brain.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19642024 2010 BDNF and PDE4, but not the GRPR, regulate viability of human medulloblastoma cells.
19631337 2009 Gastrin-releasing peptide receptor in breast cancer mediates cellular migration and interleukin-8 expression.
19478282 2009 High expression of gastrin-releasing peptide receptors in the vascular bed of urinary tract cancers: promising candidates for vascular targeting applications.
19343734 2009 Expression of the gastrin-releasing peptide receptor, the prostate stem cell antigen and the prostate-specific membrane antigen in lymph node and bone metastases of prostate cancer.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18753628 2008 Gastrin-releasing peptide receptor silencing suppresses the tumorigenesis and metastatic potential of neuroblastoma.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18663369 2010 Panic disorder is associated with the serotonin transporter gene (SLC6A4) but not the promoter region (5-HTTLPR).
18497507 2007 Gastrin-releasing peptide receptor expression in cervical cancer.
18483184 2008 Human gastrin-releasing peptide receptor gene regulation requires transcription factor binding at two distinct CRE sites.
18452185 2009 Association and linkage analysis of candidate genes GRP, GRPR, CRHR1, and TACR1 in panic disorder.
18393381 2008 Analysis of the gastrin-releasing peptide receptor gene in Italian patients with autism spectrum disorders.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17726264 2007 Overexpression of gastrin-releasing peptide receptors in tumor-associated blood vessels of human ovarian neoplasms.
17349623 2007 Gastrin-releasing peptide activates Akt through the epidermal growth factor receptor pathway and abrogates the effect of gefitinib.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15967120 2005 Gastrin-releasing peptide receptor mediates activation of the epidermal growth factor receptor in lung cancer cells.
15941862 2005 Gastrin-releasing peptide receptors in normal and neoplastic human uterus: involvement of multiple tissue compartments.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361544 2004 Alterations in receptor expression or agonist concentration change the pathways gastrin-releasing peptide receptor uses to regulate extracellular signal-regulated kinase.
14747448 2004 Gastrin releasing peptide and gastrin releasing peptide receptor expression in gastrointestinal carcinoid tumours.
14729406 2004 Gastrin-releasing peptide receptor (GRPR) locus in Japanese subjects with autism.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12771999 2003 Increased gastrin-releasing peptide (GRP) receptor expression in tumour cells confers sensitivity to [Arg6,D-Trp7,9,NmePhe8]-substance P (6-11)-induced growth inhibition.
12720295 2003 Increased frequency of gastrin-releasing peptide receptor gene mutations during colon-adenocarcinoma progression.
12526815 2002 Identification of a signaling network in lateral nucleus of amygdala important for inhibiting memory specifically related to learned fear.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12474049 2002 Expression of progastrin-releasing peptide and gastrin-releasing peptide receptor mRNA transcripts in tumor cells of patients with small cell lung cancer.
12409226 2002 GRP receptor-mediated immediate early gene expression and transcription factor Elk-1 activation in prostate cancer cells.
12220644 2002 Human gastrin-releasing peptide receptor mediates sustained CREB phosphorylation and transactivation in HuTu 80 duodenal cancer cells.
11960700 2002 Contribution of gastrin-releasing peptide and its receptor to villus development in the murine and human gastrointestinal tract.
11245983 2001 The human gastrin-releasing peptide receptor gene structure, its tissue expression and promoter.
10620630 2000 Sex-specific expression of gastrin-releasing peptide receptor: relationship to smoking history and risk of lung cancer.
9674911 1998 Exclusion of the gastrin-releasing peptide receptor (GRPR) locus as a candidate gene for Rett syndrome.
9259269 1997 Autism and multiple exostoses associated with an X;8 translocation occurring within the GRPR gene and 3' to the SDC2 gene.
8406441 1993 Comparative mapping of the Grpr locus on the X chromosomes of man and mouse.
8391296 1993 Molecular cloning and characterization of receptors for the mammalian bombesin-like peptides.
7838118 1995 Expression and characterization of cloned human bombesin receptors.
7759104 1995 A 6-Mb YAC contig in Xp22.1-p22.2 spanning the DXS69E, XE59, GLRA2, PIGA, GRPR, CALB3, and PHKA2 genes.
1655761 1991 Two distinct bombesin receptor subtypes are expressed and functional in human lung carcinoma cells.