Property Summary

NCBI Gene PubMed Count 64
PubMed Score 2732.88
PubTator Score 1520.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
ependymoma -1.400 2.2e-03
oligodendroglioma -1.200 2.5e-03
osteosarcoma 1.362 4.6e-02
intraductal papillary-mucinous adenoma (... -2.200 3.7e-04
intraductal papillary-mucinous carcinoma... -2.200 6.4e-04
lung cancer 5.200 3.0e-07
fibroadenoma 2.400 2.3e-02
sonic hedgehog group medulloblastoma -1.400 2.6e-03
invasive ductal carcinoma 2.459 4.3e-05
lung carcinoma 5.900 2.1e-45
ductal carcinoma in situ 1.500 2.0e-02
head and neck cancer and chronic obstruc... -2.000 5.7e-03
non-small cell lung cancer and chronic o... -1.800 1.4e-02
psoriasis -1.300 9.3e-08

Gene RIF (44)

PMID Text
26730601 Data show that serum neuron-specific enolase, cytokeratin 19 fragment 21-1, pro-gastrin-releasing peptide, squamous cell carcinoma antigen, tissue inhibitor of metalloproteinase-1, and human epididymis protein 4 are not associated with brain metastases.
24912045 No association of 16 GRP and 7 GRPR variants were found with agoraphobia with/without panic disorder.
24901518 Our results suggest that progastrin inhibits the acquisition of a M2-phenotype in human macrophages.
24375395 High serum proGRP levels are associated with small-cell lung cancer.
24108003 the role of autophagy in the degradation of gastrin-releasing peptide and subsequent inhibition of angiogenesis
24039782 GRP silencing decreases anchorage-independent growth, inhibits cell migration and neuroblastoma cell-mediated angiogenesis.
23924923 The levels of GRP were upregulated in cells treated with HGF in a dose-dependent manner. HGF-induced expression of Ets-1 and IL-8 was increased more by GRP treatment.
23615431 GRP-expressing C and A delta fibers that coexpress SP or CGRP makes these neurons pruriceptors.
23608754 inhibits the process of autophagy in vascular endothelial cells, thereby increasing endothelial cell proliferation and tubule formation
23379566 The Gastrin-releasing peptide(GRP)triggers the growth of HepG2 cells through blocking the ER stress-mediated pathway.
23353988 GRP serum level is higher in patients with pruritus in patients with atopic dermatitis.
22411014 Tonic stretch of human myometrium increases contractility and stimulates the expression of a known smooth muscle stimulatory agonist, GRP. GRP receptor antagonists attenuate the effect of stretch.
22399443 Data indicate that progastrin-releasing peptide (proGRP) assays with both time-resolved immunofluorometric assay (TR-IFMA) and Advanced Life Science Institute (ALSI) ELISA showed good clinical validity.
22300752 Percent changes in serum ProGRP showed better correlation to the sum of the tumor diameters (SOD) and prognostic impact than that of NSE.
22261454 Progastrin-releasing peptide cab be used as a marker for quality control in clinical sample processing and storage.
22202166 nonamidated peptides derived from the C terminus of pro-GRP are expressed in significant quantities in colorectal cancer cell lines
21529988 serum-positive non-small-cell lung cancers may have neuroendocrine differentiation
21415235 proGRP is a complementary tumour marker for prognosis and treatment monitoring in patients with neuroendocrine tumour
21281799 Abrogating GRP/GRPR signaling specifically down-regulates HP1(Hsbeta) expression and inhibiting GRPR signaling, or ablating HP1(Hsbeta) expression, increases colon cancer cell invasiveness in vitro.
21270509 Results describe the mRNA expression of CRABP1, RERG, and GRP in pituitary adenomas.
20945407 Gastrin-releasing peptide is elevated in prostate neoplasm patients undergoing androgen deprivation therapy and may be involved in the initiation of hormonal escape prostate neoplasms.
20596631 GRP promotes the growth of HepG2 cells through interaction with GRPR co-expressed in tumor cells, and subsequently activates MAPK/ERK1/2 via EGFR-independent mechanisms.
20468064 Observational study of gene-disease association. (HuGE Navigator)
19907206 Data indicate that various serum proGRP fragments are promising tools for future investigations on the relationship between fragment distribution and diagnosis and prognosis.
19506400 Tumor marker determination, incluidng ProGRP, in patients with suspicious signs of lung cancer suggests, in a few hours, the histological diagnosis in the majority of lung cancer patients.
19357287 Gastrin-releasing peptide and neuromedin B, which are found in axons in the mediobasal hypothalamus and may also be released from the gut to signal the brain, show strong direct excitatory actions on neuropeptide Y neurons.
19086053 Observational study of gene-disease association. (HuGE Navigator)
18452185 genes encoding corticotropin releasing hormone receptor 1, tachykinin receptor 1, gastrin releasing peptide, and gastrin releasing peptide receptor were selected as candidates for PD based on their biology
18452185 Observational study of gene-disease association. (HuGE Navigator)
18350254 GRP-induced up-regulation of Hsp72 promotes CD16+/94+ natural killer cell binding to colon cancer cells causing tumor cell cytolysis.
18289674 BN/GRP is produced by non-neuronal cells in the synovial tissue in rheumatoid and osteoarthritis
16920698 GRP upregulation of ICAM-1 via FAK promotes tumor cell motility and attachment to the extracellular matrix.
16909108 First evidence is provided that the calcium-ion/calcineurin/NFAT-linked pathway is involved in bombesin-mediated induction of Cox-2, a gene that promotes colon carcinoma invasiveness.
16641105 results show that TACE undergoes phosphorylation that regulates release of amphiregulin upon GRP treatment; a signaling cascade of GRP-Src-PI3-K-PDK1-TACE-amphiregulin-EGFR with multiple points of interaction, translocation & phosphorylation is suggested
15899028 BN/GRP and substance P are involved together with cytokines in the neuroimmunomodulation that occurs in the arthritic joint.
15849504 An increase in GRP binding capacity, as a result of GRP-R overexpression, down-regulates PTEN expression. Inhibition of the tumor suppressor gene PTEN may be an important regulatory mechanism involved in GRP-induced cell proliferation in neuroblastomas.
15750618 GRP is a new angiogenic peptide and that its inhibition offers an attractive tool to reduce tumor burden.
15638385 Measuring serum levels in lung cancer patients may be useful in drug therapy monitoring.
14764456 GRP is over-expressed in esophageal squamous cell carcinoma, and its over-expression may play a role in such carcinoma development and growth
13679857 Mitogenic effects of GRP in head and neck squamous cells are mediated by activation of the epidermal growth factor receptor.
12820319 results show that Pro-GRP may be a potential tumor marker for small cell lung carcinoma
12820318 ProGRP is a valuable tumour marker for the detection and monitoring of small cell lung cancer (SCLC) and a good tool for discriminating non-small cell lung cancer (NSCLC) versus SCLC
12474049 mRNA transcripts are expressed in tumor cells of patients with small cell lung cancer
11960700 GRP/GRP-R play a transient and non-critical role in intestinal development

AA Sequence

MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQ      1 - 70
LREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREG     71 - 140
RNPQLNQQ                                                                  141 - 148
//

Text Mined References (65)

PMID Year Title
26730601 2016 Serum Biomarkers Associated with Clinical Outcomes Fail to Predict Brain Metastases in Patients with Stage IV Non-Small Cell Lung Cancers.
24912045 2014 Analysis of gastrin-releasing peptide gene and gastrin-releasing peptide receptor gene in patients with agoraphobia.
24901518 2014 Progastrin represses the alternative activation of human macrophages and modulates their influence on colon cancer epithelial cells.
24375395 2014 The prognostic significance of the circulating neuroendocrine markers chromogranin A, pro-gastrin-releasing peptide, and neuron-specific enolase in patients with small-cell lung cancer.
24108003 2013 Enhanced autophagy blocks angiogenesis via degradation of gastrin-releasing peptide in neuroblastoma cells.
24039782 2013 Targeting gastrin-releasing peptide suppresses neuroblastoma progression via upregulation of PTEN signaling.
23924923 2013 Hepatocyte growth factor-mediated gastrin-releasing peptide induces IL-8 expression through Ets-1 in gastric cancer cells.
23615431 2013 Gastrin-releasing peptide-expressing nerves comprise subsets of human cutaneous A? and C fibers that may sense pruritus.
23608754 2013 Autophagy mediates paracrine regulation of vascular endothelial cells.
23379566 2013 Human gastrin-releasing peptide triggers growth of HepG2 cells through blocking endoplasmic reticulum stress-mediated apoptosis.
23353988 2013 Serum gastrin-releasing peptide levels correlate with pruritus in patients with atopic dermatitis.
22411014 2012 Expression of gastrin-releasing peptide is increased by prolonged stretch of human myometrium, and antagonists of its receptor inhibit contractility.
22399443 2012 Characteristics and clinical validity of two immunoassays for ProGRP.
22300752 2012 Correlations between serial pro-gastrin-releasing peptide and neuron-specific enolase levels, and the radiological response to treatment and survival of patients with small-cell lung cancer.
22261454 2012 Progastrin-releasing peptide is a candidate marker for quality control in clinical sample processing and storage.
22202166 2012 Pro-GRP-derived peptides are expressed in colorectal cancer cells and tumors and are biologically active in vivo.
21529988 2011 Clinicopathological findings of non-small-cell lung cancer with high serum progastrin-releasing peptide concentrations.
21415235 2011 An elevated progastrin-releasing peptide level in patients with well-differentiated neuroendocrine tumours indicates a primary tumour in the lung and predicts a shorter survival.
21281799 2011 Gastrin-releasing peptide signaling alters colon cancer invasiveness via heterochromatin protein 1Hs?.
21270509 2011 Expression of CRABP1, GRP, and RERG mRNA in clinically non-functioning and functioning pituitary adenomas.
20945407 2011 Gastrin-releasing peptide: predictor of castration-resistant prostate cancer?
20596631 2010 Gastrin-releasing peptide promotes the growth of HepG2 cells via EGFR-independent ERK1/2 activation.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
19907206 2009 Studies on multiple forms of proGRP in serum from small cell lung cancer patients.
19506400 2009 Usefulness of serum tumor markers, including progastrin-releasing peptide, in patients with lung cancer: correlation with histology.
19357287 2009 Neuromedin B and gastrin-releasing peptide excite arcuate nucleus neuropeptide Y neurons in a novel transgenic mouse expressing strong Renilla green fluorescent protein in NPY neurons.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18452185 2009 Association and linkage analysis of candidate genes GRP, GRPR, CRHR1, and TACR1 in panic disorder.
18350254 2008 GRP-induced up-regulation of Hsp72 promotes CD16+/94+ natural killer cell binding to colon cancer cells causing tumor cell cytolysis.
18289674 2008 Observations favouring the occurrence of local production and marked effects of bombesin/gastrin-releasing peptide in the synovial tissue of the human knee joint--comparisons with substance P and the NK-1 receptor.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
16920698 2007 Gastrin-releasing peptide mediates its morphogenic properties in human colon cancer by upregulating intracellular adhesion protein-1 (ICAM-1) via focal adhesion kinase.
16909108 2007 Bombesin induces cyclooxygenase-2 expression through the activation of the nuclear factor of activated T cells and enhances cell migration in Caco-2 colon carcinoma cells.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16641105 2006 Phosphorylation of TNF-alpha converting enzyme by gastrin-releasing peptide induces amphiregulin release and EGF receptor activation.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15899028 2005 Levels of gastrin-releasing peptide and substance P in synovial fluid and serum correlate with levels of cytokines in rheumatoid arthritis.
15849504 2005 Gastrin-releasing peptide-induced down-regulation of tumor suppressor protein PTEN (phosphatase and tensin homolog deleted on chromosome ten) in neuroblastomas.
15750618 2005 Gastrin-releasing peptide (GRP) induces angiogenesis and the specific GRP blocker 77427 inhibits tumor growth in vitro and in vivo.
15664365 2005 Quantification of the bombesin/gastrin releasing peptide antagonist RC-3095 by liquid chromatography-tandem mass spectrometry.
15638385 2004 Serum levels of osteoprotegerin (OPG) and pro gastrin releasing peptide (ProGRP) during chemotherapy of lung cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203211 2004 Characterization of the bombesin-like peptide receptor family in primates.
14764456 2004 Over-expression of gastrin-releasing peptide in human esophageal squamous cell carcinomas.
13679857 2003 Mitogenic effects of gastrin-releasing peptide in head and neck squamous cancer cells are mediated by activation of the epidermal growth factor receptor.
12820319 Pro-gastrin-releasing peptide (Pro-GRP), a tumor marker for small cell lung cancer.
12820318 Pro-gastrin-releasing peptide (ProGRP), neuron specific enolase (NSE), carcinoembryonic antigen (CEA) and cytokeratin 19-fragments (CYFRA 21-1) in patients with lung cancer in comparison to other lung diseases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12474049 2002 Expression of progastrin-releasing peptide and gastrin-releasing peptide receptor mRNA transcripts in tumor cells of patients with small cell lung cancer.
11960700 2002 Contribution of gastrin-releasing peptide and its receptor to villus development in the murine and human gastrointestinal tract.
11906707 2002 Identification and characterisation of functional bombesin receptors in human astrocytes.
11696365 2001 Kinetic study of the processing by dipeptidyl-peptidase IV/CD26 of neuropeptides involved in pancreatic insulin secretion.
11278902 2001 Marked differences between metalloproteases meprin A and B in substrate and peptide bond specificity.
10657515 1999 Role of bombesin-related peptides in the control of food intake.
8756537 1996 Proglucagon gene expression is induced by gastrin-releasing peptide in a mouse enteroendocrine cell line.
8137267 1994 Receptor subtype expression and responsiveness to bombesin in cultured human bronchial epithelial cells.
8008632 1994 Corticotropin-releasing factor stimulates cyclic AMP, arachidonic acid release, and growth of lung cancer cells.
7838118 1995 Expression and characterization of cloned human bombesin receptors.
6207529 1984 Cloning and characterization of cDNAs encoding human gastrin-releasing peptide.
3211139 1988 Posttranslational processing of endogenous and of baculovirus-expressed human gastrin-releasing peptide precursor.
3027902 1987 Human gastrin-releasing peptide gene is located on chromosome 18.
3027901 1987 Human gastrin-releasing peptide gene maps to chromosome band 18q21.
3003116 1986 Expression of the gastrin-releasing peptide gene in human small cell lung cancer. Evidence for alternative processing resulting in three distinct mRNAs.
3001723 1986 Two prohormones for gastrin-releasing peptide are encoded by two mRNAs differing by 19 nucleotides.
1557184 1992 Gastrin releasing peptide (GRP) binding sites in human bronchi.