Property Summary

NCBI Gene PubMed Count 322
PubMed Score 1056.77
PubTator Score 940.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytoma 1.400 2.3e-02
ependymoma 1.200 6.4e-03
oligodendroglioma 1.200 4.8e-03
psoriasis 2.900 1.4e-05
glioblastoma 1.500 4.2e-03
atypical teratoid / rhabdoid tumor 1.300 5.5e-05
Duchenne muscular dystrophy 1.013 7.6e-10
juvenile dermatomyositis 1.071 2.8e-09
tuberculosis 1.200 4.0e-06
diabetes mellitus -1.100 1.3e-02
pediatric high grade glioma 1.200 9.3e-04
pilocytic astrocytoma 1.100 9.1e-08
non primary Sjogren syndrome sicca 1.100 4.4e-02
invasive ductal carcinoma 1.320 5.8e-04
lung carcinoma -1.400 2.3e-18
mucosa-associated lymphoid tissue lympho... 1.131 2.8e-02
ovarian cancer 1.900 1.1e-04

Protein-protein Interaction (10)

Gene RIF (315)

PMID Text
27100392 Mutations in granulin are the genetic causes of frontotemporal lobar degeneration.
26682689 Our findings do not support a diagnostic value of CSF PGRN in neurodegenerative diseases. Our data confirm that levels of PGRN in plasma do not reflect accurately levels in CSF in cognitively normal controls.
26674655 In contrast with TBK1 carriers, Belgian GRN carriers were more often diagnosed with the language variant than the behavioral variant in frontotemporal dementia patients.
26607602 that progranulin could promote invasiveness of epithelial ovarian cancer cells through an epithelial mesenchymal transition program directly
26600492 We investigated the effect of progranulin (PGRN) expression on the proliferation and senescence of cervical cancer cells
26509463 Progranulin CSF concentrations and CSF/serum progranulin ratio were significantly higher in patients with infectious diseases, with disturbed BBB function and with elevated CSF cell count and presence of oligoclonal bands.
26473392 GRN mutated FTD patients were older at death and more likely to present with non-fluent aphasia. They had TDP-43 pathology.
26370502 Prosaposin facilitates sortilin-independent lysosomal trafficking of progranulin.
26339140 The study demonstrates increased PGRN expression at local sites of inflammation and association between PGRN levels, disease activity, and functional impairment in patients with Rheumatoid Arthritis.
26245842 Progranulin overproduction due to Fli-1 deficiency may contribute to the constitutive activation of SSc dermal fibroblasts by antagonizing the antifibrotic effect of TNF.
26005049 Data show that exclusive occurrence of pSer81 progranulin (PGRN) isoform in PGRN-antibody-positive patients.
25998110 The clinical phenotype in GRN carriers is often Primary progressive aphasia or Corticobasal syndrome, with 25% showing psychotic symptoms.
25888887 Serum PGRN is associated with disease activity and prognosis of DM with ILD. PGRN may play a role in the pathogenesis of DM and could be a useful biomarker.
25885205 Gain of the GEP gene copy number was observed in 20% HCC and the frequency comparable to literatures reported on the chromosome region 17q. Increased gene copy number contributed to GEP overexpression in subset of hepatocellular carcinoma.
25839164 Drebrin is critical for progranulin-dependent activation of the Akt and MAPK pathways and modulates motility, invasion and anchorage-independent growth in bladder neoplasms.
25777988 PGRN may play a critical role in homeostasis of IVD, and may serve as a potential molecular target for prevention and treatment of disc degenerative diseases.
25765123 5 (5%) of the primary progressive aphasia (PPA) patients had a genetic mutation detected: GRN (n = 3) and C9ORF72 (n = 2).
25626394 PGRN promotes differentiation and recruitment of regulatory T cells at the site of inflammation, which protects the skin from an exaggerated psoriasis-like inflammatory response.
25580532 In GRN mutation carriers, no statistically significant deregulation of ubiquitination pathway genes was observed.
25578179 investigated the association between progranulin polymorphism rs5848 and risk of the neurodegenerative disease; data indicate rs5848 is associated with risk of Alzheimer's and Parkinson's disease [meta-analysis]
25470345 This study confirmed that specific GRN single-nucleotide polymorphisms is associated with HS-Aging pathology in the Alzheimer disease.
25417056 elevated expression of secreted autocrine growth factor progranulin increases cervical cancer growth
25406312 PGRN and PIRO form a new regulatory axis in osteoclastogenesis that is included in RANK signaling in cell fusion and OC resorption of osteoclastogenesis
25377796 PGRN-mediated stimulation of the PI3K/Akt-ERK1/2/CDK4/6/pRb pathway
25365768 These results point out a critical role for sortilin in regulating progranulin action in castration-resistant prostate cancer cells, suggesting that sortilin loss may contribute to prostate cancer progression.
25261445 behavioral variant frontotemporal dementia with a novel mutation in this gene (1159_1160delTG)
25231693 Data suggest that elevated serum PRGN level can be useful biological marker for visceral adiposity and liver dysfunction in subjects with metabolic syndrome in Japan.
25115442 This study identified HS, partly through glypican-3, as a novel binding partner of GEP (Granulin-epithelin precursor)on the surface of liver cancer cells
25085782 Its mutation is associated with frontotemporal lobar degenerations.
25056957 This revealed a selective repression of progranulin translation and a reduction of mRNA levels by the 219-nucleotide-long 5' UTR.
25054309 progranulin serum concentrations in men were significantly elevated in gallstone carriers in comparison to controls
25033727 GP88 tissue and serum expression can be a prognostic biomarker in localized and advanced disease.
25027814 Progranulin treatment showed some cytoprotective effects on isolated trophoblast cells.
25024321 This study demonstrated that the EX0-5' splice site A > G mutation widens the GRN regions affected by null mutations, including the 5'-UTR, and confirms once more the large phenotypic variability linked to GRN mutations.
24993774 This study has revealed measurable group differences between GRN mutation carriers and non-carriers on standardized neuropsychological measures.
24971611 High serum progranulin is associated with insulin sensitivity and autophagic activity in metabolic syndrome.
24899141 The HpScl groups (Hippocampual Sclerosis and Hippocampual Sclerosis-AD) were more likely to exhibit genetic variants in GRN that are associated with frontotemporal lobar degeneration.
24896343 Data indicate that progranulin (PGRN) possesses multiple other actions in addition to its binding to TNF receptors (TNFR) and the inhibition of TNF-alpha/TNFR interaction.
24878635 innate antiviral and neuroprotective properties of progranulin
24814951 This is the first report of longitudinal MRI data in a nfvPPA- GRN+ patient and this report offers new insights into the pathophysiology of the disease.
24803297 The concentrations of serum progranulin were significantly higher in rheumatoid arthritis patients compared to controls.
24800652 The clinical and neuropathological phenotype of FTD patients carrying mutations in the progranulin gene, which suggests that progranulin-mediated neurodegeneration is multifactorial and influenced by other genetic and/or environmental factors.
24793792 PGRN had a critical role in the pathogenesis and chemoresistance of Glioblastoma multiforme and functioned at the top of the hierarchy of cellular machinery that modulates both DNA repair pathways and cancer stemness.
24771538 While some correlation exists between plasma and CSF PGRN, age, sex, and genetic factors differently affect PGRN levels. Therefore, caution should be taken when using plasma PGRN to predict PGRN changes in the brain.
24709683 Mutations in GRN genes encoding progranulin are rapidly increasing in up to a quarter of frontotemporal lobar degeneration cases. many of them also containing TDP-43 (TAR DNA-binding protein)43)-positive inclusions.
24680777 Progranulin polymorphism rs5848 is associated with increased risk of Alzheimer's disease.
24673545 Data suggest that serum levels of fractalkine are not different between women with gestational diabetes and control subjects, but are associated with markers of insulin resistance and progranulin in normal pregnancy.
24652679 Results indicate that mutant LRRK2 does not affect PGRN mRNA expression or intracellular PGRN protein levels/PGRN degradation in cell culture
24591016 Progranulin neutralizing antibodies occur frequently in Crohn disease and ulcerative colitis with proinflammatory effects
24503614 This study present three new patients affected by neurological syndromes included in the clinical spectrum of FTLD carrying the Cys139Arg genetic variant, thus suggesting a possible implication in the pathogenesis of FTLD.
24499389 This study shown that the GRN rs5848 SNP exerts a protective effect for the development of BD-I, decreasing the OR to 0.55, but not for the development of BD-II.
24494724 Pathological changes initiated by progranulin missense mutation results in cortical degeneration in frontotemporal lobar degeneration.
24449064 GRN mutations account for some subtypes of primary progressive aphasia.
24417980 Circulating progranulin levels were similar in acute coronary syndrome and stable angina pectoris patients compared to controls.
24387985 Its mutation is rare cause of frontotemporal dementia in Korean population.
24368088 alteration of RAP1GAP mRNA levels may explain the clinical variability of GRN- frontotemporal dementia patients
24343233 In granulin mutation carriers, genetic polymorphisms in TMEM106B improved diagnostic criteria of asymptomatic frontotemporal dementia patients.
24309270 Study shows that plasma pTDP-43 levels may be increased in some genetic forms of Fronto-Temporal Dementia (FTD), including those with a GRN mutation.
24286341 Family carries a GRN pathogenic mutation and a C9orf72 hexanucleotide repeat expansion. Pathologically the two cases were classified as FTLD-TDP type A, with additional p62-positive inclusions throughout the different brain regions.
24252750 Results show that frontotemporal lobar degeneration (FTLD)-TDP cases with GRN mutations exhibit a loss of neuronal TMEM106B subcellular localization, adding to evidence that TMEM106B and progranulin may be pathophysiologically linked in FTLD-TDP
24186875 The concentration of PGRN relates negatively to the amplified airway inflammation associated with bacterial colonization in clinically stable chronic obstructive pulmonary disease.
24163244 Data demonstrate that the SORT1-PGRN axis is a viable target for PGRN-based therapy, particularly in frontotemporal dementia-GRN patients.
24139281 Loss-of-function progranulin (PGRN) mutations have been identified as the major cause of frontotemporal lobar degeneration with TDP-43 protein inclusions (FTLD-TDP).
24120669 the osteoblastic secretome comprised 89 protein species including the powerful growth factor progranulin.
24100384 the anti-inflammatory role of progranulin is not mediated through direct inhibition of TNFR1.
24081456 The rate of GRN mutation-positive FTLD in this series was 15.4%. Categories designating the risk level for hereditary cause were termed high, medium, low, apparent sporadic, and unknown significance.
24070898 Progranulin directly binds to the CRD2 and CRD3 of TNFR extracellular domains.
24018267 This study demonstrated: i) an increase of circulating SLPI levels in affected frontotemporal lobar degeneration ii) an age-related upregulation of the serine-protease inhibitor in response to lifetime progranulin shortage.
24009671 Pgrn is a novel, robust and independent prognostic marker in CLL that can be easily measured by ELISA.
24005336 This study documents GRN mutation-related brain metabolic abnormalities prior to onset of full-blown frontotemporal dementia.
23847387 PGRN seems to be involved in the pathogenesis of atherosclerosis, possibly by various anti-atherogenic effects, including modulation of local and/or systemic inflammation.
23702100 After prednisone treatment, the serum levels of progranulin decreased significantly, and the relative expression of progranulin mRNA was decreased by 1.34-fold compared with the untreated controls
23684369 Pathogenic GRN mutations probably have a low prevalence in non-frontotemporal dementia.
23609919 [review] Mutations in the progranulin gene are risk factors for Alzheimer's disease clinical phenotypes and neuropathology.
23596077 Patients with GRN A9D mutations are diagnosed with amyotrophic lateral sclerosis, atypical extrapyramidal disorder and frontotemporal dementia.
23478307 We describe a case of late onset frontotemporal dementia carrying the mutation in progranulin (GRN) gene
23476101 The results suggested that Plasma progranulin concentrations were higher in Chinese patients with type 2 diabetes and obesity and correlated closely with glycolipid metabolism, chronic inflammation and IR.
23463024 Serum-GRN levels were found to be >50% reduced compared with frontotemporal lobar degeneration patients without GRN mutations.
23419701 Leukocyte mRNA levels of TMEM40 and LY6G6F are significantly higher in frontotemporal lobar degeneration patients carrying granulin mutations compared with asymptomatic carriers.
23409033 Serum progranulin levels are significantly associated with systemic inflammatory markers and were an independent predictor for atherosclerosis in subjects without metabolic syndrome.
23398167 Reduced circulating GRN levels might be associated with Parkinson's disease risk by pathogenic factors different from rs5848 and rs646776 polymorphisms.
23396349 PGRN may not be a good biomarker for Alzheimer's disease; moreover, gender may influence the plasma PGRN levels of Alzheimer's disease patients
23364791 circulating progranulin exists as a dimer and is not likely a component of HDL.
23342160 Findings show that the GRN rs5848 TT genotype and T allele are risk factors for female Taiwanese patients with PD.
23338682 GRN mutation carriers develop frontotemporal lobar degeneration at a later age than C9orf72 expansion carriers.
23317568 Our results suggest that MAPT, PGRN and APOE play limited roles in frontotemporal lobar degeneration pathogenesis among Indians
23236149 A potential mechanism linking misregulation of sortilin splicing with altered PGRN metabolism, is proposed.
23218900 study found asymptomatic c.709-1G>A GRN mutation carriers might have a different pattern of age-related cortical thinning in superior and middle temporal gyri and the banks of the superior temporal sulcus compared with noncarriers, suggesting an early and disease-specific effect in these areas
23158232 Poorer performance on these tests in asymptomatic PGRN mutation carriers may reflect a prodromal phase preceding the onset of clinically significant symptoms of frontotemporal dementia.
23140401 Data indicate that serum progranulin (PGRN) levels are significantly decreased after ameliorating the disease with treatment.
22986778 The aim of this study was to investigate the relationship between grey (GM) and white matter (WM) microstructural damage in frontotemporal lobe degeneration patients, carriers and non-carriers of the granulin mutation.
22945272 Increased expression of progranulin protein in villous trophoblast cells in cases of preeclampsia and fetal growth restriction may result from disturbed placental development and, therefore, may be of pathogenetic importance.
22890101 Estimation of the progranulin p.Leu271LeufsX10 mutation has been traced back to a single founder in the Middle Ages who had frontotemporal lobe dementia and lived in Italy.
22890097 The A allele of rs5848 is functionally relevant by reducing the expression of granulin in the inferior temporal cortex of neuropathologically confirmed Alzheimer's disease patients.
22859297 Progranulin: a proteolytically processed protein at the crossroads of inflammation and neurodegeneration.
22819134 This study reveled that the unusually high prevalence and the clinical phenotype associated with different GRN mutations.
22802426 PGRN concentrations are markedly lower after pregnancy regardless of the gestational glucose tolerance state. PGRN levels per se do not discriminate between mild gestational diabetes and normal glucose tolerance in pregnant women.
22797721 The degree of methylation of the GRN promoter is increased in patients with FTLD as compared with controls, likely leading to a decreased expression of GRN.
22792281 TPM3 is an interacting partner of granulin-epithelin precursor and may play an important role in hepatocarcinogenesis.
22787763 Progress in clinical genetics concerning PGRN, one of the putative genes for FTLD, was reviewed and physiological functions and neuro-degeerative mechanism of the gene were discussed.
22761921 Serum PGRN levels were clinically significant for predicting recurrence in patients with HR-positive breast cancer during adjuvant tamoxifen therapy
22665040 PKC signaling is involved in the regulation of progranulin protein expression in 2 different ovarian cancer cell lines.
22647257 GRN null mutations are detected in Spanish patients with severely reduced serum PGRN levels, but not in patients with slightly reduced PGRN levels.
22623979 Inactivation of CDK/pRb pathway normalizes survival pattern of lymphoblasts expressing the FTLD-progranulin mutation c.709-1G>A.
22608501 analysis of different clinicopathological phenotypes determined by progranulin-mutation dosage
22509390 Our results establish microglia as a significant source of progranulin(PGRN), and MMP-12 and SLPI as modulators of PGRN proteolysis
22505994 GRN variability decreases the risk to develop BPD and schizophrenia, and progranulin plasma levels are significantly lower in BPD patients than in controls.
22491866 monozygotic twins demonstrated strong clinical, neuroimaging, and serum progranulin level similarities, demonstrating the importance of shared genetic profiles beyond environmental influences in the symptomatic expression of the disease.
22397762 A significantly higher expression level of progranulin in pN(-) TNBC suggests that progranulin is a promising new target for pN(-) TNBC treatment.
22366795 Patterns of atrophy therefore differed across subjects with C9ORF72, tau and progranulin mutations and sporadic frontotemporal dementia
22348647 The Mutation of PGRN is involved in patients with Frontotemporal lobar degeneration.
22338605 The aim of this review is to highlight what is known regarding PGRN biology--{REVIEW}
22316048 The survival factor GP88 is a novel prognostic biomarker, predictive of recurrence risk and increased mortality for non-metastatic estrogen receptor positive invasive ductal carcinoma patients.
22280948 Current cases show that intrafamilial phenotypic heterogeneity may be encountered with the GRN p.Glu498fs mutation, which leads to progranulin haploinsufficiency.
22204653 Receiver operating characteristic curves analysis confirmed that serum GRN can provide diagnostic discriminations for gastric cancer patients.
22194816 Protein expression of GEP in fetal and adult livers was examined in human and mouse models by immunohistochemical staining and flow cytometry.
22176685 Lysophosphatidic acid activation of PGRN involving the ERK pathway is critical to promote MDA-MB-231 breast cancer cell invasion.
22130207 these findings suggest that compensatory mechanisms of brain plasticity are present in GRN-related frontotemporal lobar degeneration, but with different patterns at a preclinical and symptomatic disease stage.
22127750 study denomistrated that Genetic screening identified patients bearing PGRN mutaton but still the majority of FTLD cases with an inherited familial trait are negative to genetic analyses.
22088468 Progranulin proteins were overexpressed in breast cancer. Progranulin may be a valuable marker for assessing the metastasis and prognosis of breast cancer, and could provide the basis for new combination regimens with antiangiogenic activity
22068162 Progranulin expression is upregulated in cholangiocarcinoma and progranulin exerts growth-promoting effects on cholangiocarcinoma.
22045426 Compared with controls, nonalcoholic fatty liver disease patients have higher serum progranulin concentrations, which are closely associated with lipid values and the extent of hepatic fibrosis
22032330 The miRNA family of ncRNAs showed distinct expression patterns in post-mortem brain tissue of FTLD-TDP patients carrying loss-of function mutations in PGRN compared to FTLD-TDP patients without known mutations.
21892962 Data show that plasma progranulin levels were reduced in a subgroup of patients with autism.
21891869 This study suggested that GRN mutation possible cause of the Frontotemporal lobar degeneration.
21891865 This study suggested that GRN mutation carriers have normal or borderline CSF biomarkers regardless of the clinical presentation and the speci fi ctype of mutation.
21813674 This study demonistrated that PGRN knockdown severely alters neuronal connectivity in vitro and that the synaptic vesicle phenotype observed in culture is consistent with that observed in the hippocampus of FTD patients
21802097 Changes of progranulin in amyotrophic lateral sclerosis (ALS) skin are related to the disease process and metabolic alteration of progranulin may take place in the skin of patients with ALS.
21800185 Occurrence of GRN mutations in Tuscany, Central Italy, confirming that genetic variations in this gene could be a considerable genetic cause of frontotemporal lobar degeneration.
21753165 Subjects with FTD with GRN mutations have a faster rate of whole brain atrophy than subjects with FTD with MAPT mutations, with similar rates of hippocampal atrophy.
21707777 These findings suggest that the upregulation of PGRN via the p38MAPK and MEK1/2 signaling pathway in Helicobacter pylori-infected gastric epithelial cells may contribute to the carcinogenic process.
21677378 Our data extend the phenotypic spectrum and the complexity of neurodegenerative diseases linked to GRN mutations
21645364 Data suggest that circulating IL-6 is increased in progranulin (PGRN)-mutated frontotemporal lobar degeneration (FTLD) patients, as compared to both PGRN non-mutated FTLD patients and controls.
21482928 Patients with the c.26C>A progranuliln mutation appear to have a younger age at onset of frontotemporal lobar degeneration and at death and more parkinsonian features than those with other progranulin mutations.
21454553 Suberoylanilide hydroxamic acid (vorinostat) up-regulates progranulin transcription
21393509 study reports PGRN bound directly to tumor necrosis factor receptors and disturbed the TNFalpha-TNFR interaction.
21289198 Elevation of GRN levels occurs via a translational mechanism independent of lysosomal degradation, autophagy, or endocytosis.
21263192 Urinary proepithelin may be considered as a non-invasive, sensitive, and specific urine-based test for bladder cancer diagnosis and/or prognosis.
21258152 the clinical heterogeneity of frontotemporal dementia associated with the GRN Asp22fs mutation in a large Italian family
21232819 Here we show that progranulin deficit increased cell cycle activity in immortalized lymphocytes.
21224065 These data demonstrate that progranulin acts as a chemoattractant in the brain to recruit or activate microglia and can increase endocytosis of extracellular peptides such as amyloid beta.
21212639 The homozygous TT genotype of the progranulin allele rs5848 may play a role in the genetic risk of Alzheimer disease development
21204008 PGRN plays an important role in neurite outgrowth
21178100 TMEM106B SNPs significantly reduced the disease penetrance in patients with GRN mutations, potentially by modulating GRN levels.
21123963 Progranulin expression in the human placenta differs between the first and third trimester.
21107132 Upregulation of progranulin is a marker of the microglial response that occurs with progression in motor neuron diseases.
21087763 identified significant association of a locus on chromosome 1p13.3 with plasma GRN levels through an unbiased genome-wide screening approach and implicated SORT1 as an important regulator of GRN levels
21085476 Data show that comparing to T2D the IFG subjects had higher serum chemerin, progranulin, fetuin-A and RBP4 levels which was not detectable in the comparison of the T2D and IGT group.
21047645 the T allele of the rs5848 polymorphism is associated with a lower serum PGRN levels in populations beyond FTLD-TDP and may thereby increase the risk of other neurodegenerative conditions.
21047645 Observational study of gene-disease association. (HuGE Navigator)
20975516 we identified a novel exon 6 splice donor site deletion (IVS6+5_8delGTGA) in in the progranulin gene in 2 unrelated patients with Frontotemporal lobar degeneration
20947212 frontotemporal lobar degeneration (FTLD) patients with homogeneous genetic background well may be used in the search of disease modulators to elucidate genotype-phenotype correlations of progranulopathies(Progranulin Thr272fs mutation).
20933034 PGRN can exert a protective role against hypoxic stress in the brain, a principal risk factor involved in the pathogenesis of frontotemporal dementia.
20930271 the novel frame-shift mutation T278SfsX7 in progranulin of patients with frontotemporal lobar degeneration
20930269 The novel PGRN mutation is a disease-causing mutation and is associated with substantial intra-familial clinical heterogeneity in frontotemporal dementia.
20884628 Findings indicate that the mitogen and growth factor GRN is dysregulated via the miR-15/107 gene group in multiple human cancers, which may provide a potential common therapeutic target.
20858962 Prospective serum screening is a surrogate diagnostic marker for progranulin mutations.
20858962 Observational study of genetic testing. (HuGE Navigator)
20798611 Observational study of gene-disease association. (HuGE Navigator)
20711061 Observational study of gene-disease association. (HuGE Navigator)
20682318 Expression of GEP and ABCB5 in liver cancer stem cells is associated with chemoresistance and reduced survival times of patients with hepatocellular carcinoma.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20570546 study reports an Italian family with rapidly progressing frontotemporal dementia with parkinsonism associated with the GRN c.C1021T mutation
20489155 These findings indicate that miR-107 contributes to granulin expression regulation with implications for brain disorders.
20479936 These findings identify miR-29b as a novel posttranscriptional regulator of PGRN expression, raising the possibility that miR-29b or other miRNAs might be targeted therapeutically to increase hPGRN levels in some frontotemporal dementia patients.
20463744 Progranulin gene haplotypes influence the risk of developing primary progressive multiple sclerosis in males.
20463744 Observational study of gene-disease association. (HuGE Navigator)
20387302 evidence for a role of circulating GRN as a biochemical biomarker in neurodegeneration is reviewed, with a specific focus on its relevance in Alzheimer's disease
20237496 Observational study of gene-disease association. (HuGE Navigator)
20215705 the anti-inflammatory effects of HDL/APOAI on macrophages might be due to suppression of the conversion of progranulin into proinflammatory granulins by forming a complex.
20197700 The results of this study suggested that a genetic variant in GRN may be a risk factor for hippocampal sclerosis in the elderly.
20197700 Observational study of gene-disease association. (HuGE Navigator)
20171924 Observational study of gene-disease association. (HuGE Navigator)
20154673 TMEM106B variants also contribute to genetic risk for frontotemporal lobar degeneration with TDP-43 inclusions in individuals with mutations in GRN.
20142525 Alzheimer disease-like phenotype associated with the c.154delA mutation in progranulin.
20142524 Pathogenic mutations were found only in frontotemporal dementia-spectrum cases and not in other related neurodegenerative diseases. Haploinsufficiency of GRN is the predominant mechanism leading to frontotemporal dementia.
20087814 Data suggest that there may be an association between schizophrenia, frontotemporal dementia, and granulin mutations in Latino populations that should be investigated further.
20061636 The progranulin genotype represents a susceptibility factor for development of frontotemporal lobar degeneration in individuals who do not carry GRN causal mutations.
20061636 Observational study of gene-disease association. (HuGE Navigator)
20054825 Suggest that intracellular GEP is a promoter-specific transcriptional repressor that modulates the function of cellular and viral transcription factors.
20054825 Granulin forms stable complexes with cyclin T1 and HIV-1 Tat and inhibits Tat transactivation of the viral LTR promoter
20045477 the effects of GRN and MAPT mutations are expressed in partly overlapping but distinct anatomical networks that link specific molecular dysfunction with clinical phenotype.
20028451 mutations affect the function of full-length PGRN as well as elastase cleavage of PGRN into GRNs, leading to neurodegeneration
20020531 Sixteen different non-synonymous changes, eleven of which are novel variants, were identified in GRN AND MAPT.
19963041 According to these data, progranulin does not likely play a major role in the pathogenesis of multiple sclerosis
19940479 alterations in gene copy number of PGRN and MAPT are not a cause of disease in a collection of frontotemporal lobar degeneration patients
19940479 Observational study of gene-disease association. (HuGE Navigator)
19938685 Recent studies have identified 44 different mutations in more than 100 families with FTDP-17 (MAPT), and 66 different mutations in more than 100 families with FTDP-17 (PGRN).
19913121 Observational study of gene-disease association. (HuGE Navigator)
19864668 study describes the presence of a novel 1048_1049insG GRN mutation in family DRC219 in which the proband has a corticobasal syndrome associated with behavioural symptoms
19863344 Progranulin activated the MAPK-signaling pathway in NIH-OVCAR-3 cells. Progranulin expression may be potentially involved in the pathogenesis and malignant progression of ovarian cancer
19858458 "Frontotemporoparietal" dementia patients carrying the c.709-1G>A single pathogenic splicing mutation in the PGRN gene showed heterogeneous clinical and neuropsychological features and commonly developed corticobasal syndrome as the disease progressed.
19847305 variation of GRN at rs5848 does not contribute to the etiology of frontotemporal lobar degeneration in the Dutch population
19847305 Observational study of gene-disease association. (HuGE Navigator)
19795409 PGRN has roles in diseases ranging from cancer to dementia [review]
19730171 our finding further supports the idea that progranulin mutations might indeed represent a novel, significant genetic determinant of Frontotemporal Lobar Degeneration in Northern Italy.
19730170 both PGRN and MAPT genes seem not to be the major genetic cause of frontotemporal lobar degeneration in Northern Italy
19649643 GRN mutation carriers have increased levels of mRNA transcript from the normal allele in brain, and proliferation of microglia likely increases progranulin levels in affected regions of the frontotemporal lobar degeneration with TDP-43 inclusions brain
19649643 Observational study of gene-disease association. (HuGE Navigator)
19632744 This study suggested that No major progranulin genetic variability contribution to disease etiopathogenesis in an ALS in Italy.
19632744 Observational study of gene-disease association. (HuGE Navigator)
19625741 Grn protein mutation influence mRNA levels in brain and peripheral mononuclear cells in patients with Alzheimer's disease.
19625741 Observational study of gene-disease association. (HuGE Navigator)
19618231 Observational study of gene-disease association. (HuGE Navigator)
19487464 Findings demonstrate that ADAMTS-7, a direct target of PTHrP signaling, negatively regulates endochondral bone formation by associating with and inactivating GEP chondrogenic growth factor.
19473366 This finding shows that GRN rs5848 does not affect the risk of Parkinson's disease in the US and Polish populations
19473366 Observational study of gene-disease association. (HuGE Navigator)
19446372 These data argue that homozygosity of the single nucleotide polymorphism rs5848 on the 3'UTR of progranulin is not a risk factor for frontotemporal lobar degeneration.
19321167 The expression of PGRN mainly reduces inflammation and its degradation into GRNs enhances inflammation in atherosclerotic plaque and may contribute to the progression of atherosclerosis.
19255408 Patterns of atrophy identified on head magnetic resonance imaging show no regions of greater gray matter loss in subjects with mutations in PGRN, compared to gray matter loss in subjects with mutations of microtubule-associated protein tau (MAPT) gene.
19237611 Proepithelin may prove a novel biomarker for the diagnosis and prognosis of bladder neoplasms.
19179604 Proepithelin may play a critical role as an autocrine growth factor in the establishment and initial progression of prostate cancer.
19158106 Observational study of genetic testing. (HuGE Navigator)
19133655 This study demenostreated that a new progranulin gene mutation (Arg547Cys) in a Parkinsonism and impulse control disorder.
19101631 study estimated the contribution of the PGRN Leu271LeufsX10 mutation to frontotemporal lobar degeneration and related disorders in the Brescia cohort
19101631 Observational study of gene-disease association. (HuGE Navigator)
19091059 Observational study of gene-disease association. (HuGE Navigator)
19056610 Progranulin is a novel marker of chronic inflammation in obesity and type 2 diabetes that closely reflects omental adipose tissue macrophage infiltration.
19049508 Mutations in progranulin are rare among Finnish patients with frontotemporal lobar dementia (FTLD) and FTLD-motor neuron disease. Single nucleotide polymorphisms are frequent and suggest high genetic variability of the progranulin gene.
19049508 Observational study of gene-disease association. (HuGE Navigator)
19020205 We identified a novel Cys521Tyr progranulin gene variant in a progressive nonfluent aphasia family. Cys521Tyr may be associated with early brain impairment not limited to language areas and compensated by recruitment of bilateral auxiliary cortical areas.
19016491 Genetic variability in the GRN gene may also increase the risk for developing Alzheimer disease in a gender-specific manner.
19016491 Observational study of gene-disease association. (HuGE Navigator)
19012866 findings add further support to the significance of GRN in frontotemporal dementia etiology and the presence of modifying genes
18955727 Data show progranulin immunoreactivity throughout the medial temporal lobe in all dementia with Lewy bodies.
18855025 Data suggest that the progranulin Gly35fs mutation causes frontotemporal dementia with variable clinical presentation in a large Swedish family, most likely through nonsense-mediated decay of mutant PGRN mRNA and resulting haploinsufficiency.
18848708 This study found increased staining for PGRN in motor tracts with vacuolar degeneration and glial cells in ALS sample spinal cord and brainstem sections compared to controls.
18838661 Our results do not support a major role for PGRN in the genetic etiology of Parkinson disease
18838661 Observational study of gene-disease association. (HuGE Navigator)
18771956 Mutations in the gene that encodes progranulin (GRN) on chromosome 17q21-22 have been identified in patients with hereditary FTD who have tau-negative, ubiquitin-positive inclusions.
18768919 Data demonstrate that progranulin protein is strongly reduced in plasma and CSF of affected and unaffected subjects carrying mutations in progranulin gene (PGRN Leu271LeufsX10 and Q341X).
18768919 Observational study of genetic testing. (HuGE Navigator)
18752597 In a patient with late-onset Alzheimer's disease, a novel allelic variant in exon 1 (g100169G > A) leads to p.Gly35Arg.
18752597 Observational study of gene-disease association. (HuGE Navigator)
18723524 Genetic variability in a miR-659 binding-site of GNR increased the risk for TDP-43 positive frontotemporal dementia.
18723524 Observational study of gene-disease association. (HuGE Navigator)
18723384 There were no mutations in GRN inperry syndrome.
18706200 Results show that PCDGF have higher expression in esophageal squamous cell carcinoma, which indicate that they have a close relationship with angiogenesis.
18593276 Brain magnetic resonance imaging structural changes in a pedigree of asymptomatic progranulin mutation carriers.
18565828 Our data support a role for PGRN in patients with clinically diagnosed Alzheimer disease (AD). Further, we hypothesize that at least some PGRN missense mutations might lead to loss of functional protein.
18565828 Observational study of gene-disease association. (HuGE Navigator)
18551524 We report the following findings: (1) confirmation of high progranulin expression levels in peripheral blood; (2) two subjects with reduced progranulin levels and mutations in the PGRN gene confirmed by direct sequencing.
18551524 Observational study of gene-disease association. (HuGE Navigator)
18543312 Although the complete phenotypic spectrum associated with GRN mutations is not yet fully characterized, it was shown that it is highlyheterogeneous, suggesting the influence of modifying factors.
18479928 PGRN mutations exert their pathogenic effect through haploinsufficiency and underlines the diversity of clinical presentations associated with these PGRN alterations.
18464284 Two mutations were found: a novel pathogenic insertion (p.Gln300GlnfsX61) and a previously described point variant (p.T182M) of unclear pathogenicity in one of patients.
18442119 This study further expands the clinical and pathological spectrum of PGRN mutations, and suggests the diagnosis could be missed in some individuals with atypical presentations.
18413474 Describe the clinical, neuropsychologic, and radiologic features of a family with a C31LfsX35 mutation in the progranulin gene CCDS11483.1
18413467 Features in patients with FTDP linked to mutations in MAPT and PGRN, highlighting the many similarities but also a few important differences.
18392865 one PGRN pathogenetic mutation was found, consisting of a four-base pair deletion in the coding sequence of exon 8 (delCACT) in frontotemporal lobar degeneration
18392865 Observational study of gene-disease association. (HuGE Navigator)
18378771 Study reports that PGRN levels are reduced in the cerebrospinal fluid from frontotemporal lobe dementia patients with a PGRN mutation; PGRN and its proteolytic fragments promote neuronal survival and enhance neurite outgrowth in cultured neurons.
18359860 High-resolution NMR showed that only the three GEMs, hGrnA, hGrnC, and hGrnF, contain relatively well-defined three-dimensional structures in solution, while others are mainly mixtures of poorly structured disulfide isomers.
18322394 An asymmetric degenerative process is associated with mutations in the progranulin (PGRN) gene and is seen in 3 PGRN cases presenting with either corticobasal syndrome or frontotemporal dementia and language deterioration.
18314228 This study identified two novel heterozygous mutations in two unrelated patients, Cys139Arg in the PGRN gene and Val412Ile in the PSEN1 gene.
18245784 the clinical diagnosis at onset was fvFTD in 63% (20/32) of the mutation carriers, PPA in 16% (5/32), Alzheimer's disease in 9% (3/32), CBDS and LBD each in 6% (2/32) of the mutation carriers.
18234697 patients with GRN mutations: have a shorter disease duration (with the exception of FTD-MND); present bvFTLD, language output impairment or with CBS; have parietal lobe dysfunction; and have evidence of asymmetrical brain atrophy on MR imaging.
18234697 Observational study of gene-disease association. (HuGE Navigator)
18223198 Findings demonstrate a distinct molecular phenotype for GRN in frontotemporal lobar degeneration with ubiquitinated inclusions, not readily apparent on clinical or histopathological examination.
18192287 sequencing of PGRN in 223 consecutive patients with FTLD revealed the presence of 13 mutations, or 14 mutations if a single affected sibling of two other affected siblings with proven PGRN mutation is included.
18184915 PGRN acts as a modifier of the course of disease in patients with amyotrophic lateral sclerosis, through earlier onset and shorter survival.
18184915 Observational study of gene-disease association. (HuGE Navigator)
18183624 2 pathogenic progranulin gene mutations in 4 frontotemporal dementia families were discovered: a single-base substitution within the 3' splice acceptor site of intron 6/exon 7 (g.5913A>G [IVS6-2A>G]) & a missense mutation in exon 1 (g.4068C>A)
18166610 MAPT and PGRN are responsible for the largest number of familial cases. Each of these genes differs by disease mechanism. Moreover mutations in both genes are associated with significant interfamilial and intrafamilial phenotypic variation.
18157829 reduced PGRN in absence of mutant protein is sufficient to cause neurodegeneration and that previously reported PGRN mutation frequencies are underestimated.
17984093 A progranulin mutation located within the signal sequence (PGRN A9D) results in cytoplasmic missorting with extremely low expression.
17950702 Progranulopathies are a major cause of the main phenotypes included in the FTLD complex.
17949857 Age of onset, clinical phenotypes and MRI findings associated with most PGRN mutations varied significantly both within and among kindreds. Some kindreds with PGRN mutations exhibited lateralized topography of degeneration across all affected individuals.
17826340 Observational study of genotype prevalence. (HuGE Navigator)
17826340 Clinical heterogeneity is associated with GRN haploinsufficiency, and genetic variability on the wild-type GRN allele might have a role in the age-related disease penetrance of GRN mutations.
17698705 Patients with a GRN mutation differ clinically from those with the same pathologic diagnosis but no GRN mutation.
17620546 The current results imply further genetic heterogeneity of frontotemporal dementia, as we detected only one GRN-linked family (about 1%). The value of discovering large kindred includes the possibility of a longitudinal study of GRN mutation carriers.
17572900 Progranulin mutations cause haploinsufficiency leading to TDP-43 accumulation in frontotemporal lobar degeneration.
17522386 PGRN mutations at 17q21 may occur in apparently sporadic frontotemporal lobar dementia with ubiquitinated inclusions cases and in cases presenting with either primary progressive aphasia or the behavioral variant of frontotemporal dementia.
17458552 Marked variation of the clinical phenotype makes it difficult to predict which cases of familial frontotemporal dementia will turn out to have a progranulin mutation.
17439980 A single GRN mutation in the two families studied was associated with variable clinical presentations consistent with the frontotemporal dementia syndrome
17436289 Observational study of genotype prevalence. (HuGE Navigator)
17436289 Progranulin null mutations in both sporadic and familial frontotemporal dementia.
17417739 We describe a new mutation in the PGRN gene (A303AfsX57) associated with late-onset frontotemporal dementia and with "cat's eye" shaped intranuclear and cytoplasmatic ubiquitin immunoreactive inclusions in the neuropathological exam.
17383054 The results revealed that the common variations in IFT74 and GRN neither constitute strong ALS risk factors nor modify the age-at-onset.
17383054 Observational study of gene-disease association. (HuGE Navigator)
17371905 Observational study of genotype prevalence. (HuGE Navigator)
17371905 PGRN mutations are not a common cause of amyotrophic lateral sclerosis phenotypes
17353379 Findings from this study suggest that PGRN mutations may be associated with a specific and severe pattern of cerebral atrophy in subjects with ubiquitin-positive inclusions.
17345602 the mutation spectrum in PGRN leading to loss of functional PGRN as the basis for frontotemporal dementia
17291356 Increased PGRN expression by microglia may play a pivotal role in the response to brain injury, neuroinflammation and neurodegeneration.
17278999 Observational study of gene-disease association. (HuGE Navigator)
17266030 Granulin-epithelin precursor overexpression was associated with CDDP chemoresistance. Finally, GEP overexpression increased tumor formation and protected cells from tumor regression in response to CDDP treatment in vivo
17261172 PCDGF plays an important role in stimulating proliferation and promoting invasion in ovarian cancer.
17228326 Observational study of genotype prevalence. (HuGE Navigator)
17228326 Two novel frameshift mutations and three possible pathogenic missense mutations are reported.
17210807 primary progressive aphasia has Progranulin mutations.
17202431 Mutations in progranulin (PGRN), predicted to cause premature truncation of the PGRN coding sequence, are found in patients with inherited FTLD with immunoreactive ubiquitin (ub-ir) inclusions (FTDL-U) and ub-ir neuronal intranuclear inclusions.
17157414 This study identified a novel 4 bp deletion mutation in exon 7 of PGRN gene (Leu271LeufsX10) associated with a variable clinical presentation ranging from FTDP-17 to corticobasal syndrome.
16983685 familial frontotemporal lobar degeneration with ubiquitin-positive, tau-negative inclusions caused by a missense mutation in the signal peptide of progranulin.(ALA-9 ASP).
16983677 This study discovered a new PGRN mutation (R493X) resulting in a stop codon in two frontotemporal dementia patients.
16950801 Observational study of gene-disease association. (HuGE Navigator)
16950801 Patients with PGRN mutations revealed variable onset ages with language dysfunction as a common presenting symptom, neuropathological examination showed dementia with ubiquitin-positive inclusions in all PGRN mutation carriers.
16862116 results identify mutations in PGRN as a cause of neurodegenerative disease and indicate the importance of PGRN function for neuronal survival
16862115 PGRN haploinsufficiency leads to neurodegeneration because of reduced PGRN-mediated neuronal survival; and involvement of PGRN in frontotemporal dementia pathogenesis
16857791 PC cell-derived growth factor stimulates proliferation and confers Trastuzumab resistance to Her-2-overexpressing breast cancer cells
16533762 Overexpression of acrogranin is associated with uterine leiomyosarcoma
15653695 Data show that the granulin/epithelin precursor and some of its constituent granulin repeats can inhibit HIV-1 transcription via Tat without directly binding to cyclin T1.
15653695 Granulin forms stable complexes with cyclin T1 and HIV-1 Tat and inhibits Tat transactivation of the viral LTR promoter
15569995 the Granulin-epithelin precursor has a role in hepatocellular carcinoma growth, invasion, and metastasis
14977833 PCDGF has a role in the development of prostatic intraepithelial neoplasia
14652816 an important role of PCDGF in breast cancer pathogenesis and a potential novel target for the treatment of breast cancer
12931033 identified two proteins that interacted with the Tat protein of the caprine arthritis encephalitis virus: the EGF-like repeats 1-6 of the extracellular domain of the human Notch2 receptor and the epithelin/granulin growth factor precursor
12914763 PC-cell-derived growth factor has a critical role in breast cancer tumorigenesis.
12588988 granulin is a cellular protein that interacts with cyclin T1 to inhibit transcription
12588988 Granulin forms stable complexes with cyclin T1 and HIV-1 Tat and inhibits Tat transactivation of the viral LTR promoter
12538450 PCDGF has a role as a new autocrine growth factor in epithelial ovarian cancer
12526812 PEPI has a role in wound healing and innate immunity
12031912 downregulated significantly in acute myeloid leukemia patients whose white blood cell count was higher than 100 x 10(9)/L cells
10079180 Granulin forms stable complexes with cyclin T1 and HIV-1 Tat and inhibits Tat transactivation of the viral LTR promoter

AA Sequence

MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAG      1 - 70
HSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCC     71 - 140
VMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPD    141 - 210
ARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVG    211 - 280
DVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPA    281 - 350
HLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGS    351 - 420
EIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNV    421 - 490
KARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCP    491 - 560
AGFRCAARGTKCLRREAPRWDAPLRDPALRQLL                                         561 - 593
//

Text Mined References (323)

PMID Year Title
27100392 2016 Characterization of Movement Disorder Phenomenology in Genetically Proven, Familial Frontotemporal Lobar Degeneration: A Systematic Review and Meta-Analysis.
26682689 2016 Progranulin Protein Levels in Cerebrospinal Fluid in Primary Neurodegenerative Dementias.
26674655 2016 Clinical features of TBK1 carriers compared with C9orf72, GRN and non-mutation carriers in a Belgian cohort.
26607602 2016 PGRN promotes migration and invasion of epithelial ovarian cancer cells through an epithelial mesenchymal transition program and the activation of cancer associated fibroblasts.
26600492 2015 Effect of progranulin (PGRN) on the proliferation and senescence of cervical cancer cells.
26509463 2016 Quantification and regulation of the adipokines resistin and progranulin in human cerebrospinal fluid.
26473392 2015 Distinct clinical and pathological phenotypes in frontotemporal dementia associated with MAPT, PGRN and C9orf72 mutations.
26370502 2015 Prosaposin facilitates sortilin-independent lysosomal trafficking of progranulin.
26339140 2015 Progranulin Is Associated with Disease Activity in Patients with Rheumatoid Arthritis.
26245842 2015 Progranulin Overproduction Due to Fli-1 Deficiency Contributes to the Resistance of Dermal Fibroblasts to Tumor Necrosis Factor in Systemic Sclerosis.
26005049 2015 The molecular basis for development of proinflammatory autoantibodies to progranulin.
25998110 2015 The frontotemporal dementias.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25888887 2015 Serum progranulin levels are elevated in dermatomyositis patients with acute interstitial lung disease, predicting prognosis.
25885205 2015 Copy number gain of granulin-epithelin precursor (GEP) at chromosome 17q21 associates with overexpression in human liver cancer.
25839164 2015 A novel role for drebrin in regulating progranulin bioactivity in bladder cancer.
25777988 2015 Progranulin knockout accelerates intervertebral disc degeneration in aging mice.
25765123 2015 Dominant frontotemporal dementia mutations in 140 cases of primary progressive aphasia and speech apraxia.
25626394 2015 Progranulin is preferentially expressed in patients with psoriasis vulgaris and protects mice from psoriasis-like skin inflammation.
25580532 2015 Profiling of ubiquitination pathway genes in peripheral cells from patients with frontotemporal dementia due to C9ORF72 and GRN mutations.
25578179 2015 Association of progranulin polymorphism rs5848 with neurodegenerative diseases: a meta-analysis.
25470345 2015 Reassessment of risk genotypes (GRN, TMEM106B, and ABCC9 variants) associated with hippocampal sclerosis of aging pathology.
25417056 2015 Elevated expression of secreted autocrine growth factor progranulin increases cervical cancer growth.
25416956 2014 A proteome-scale map of the human interactome network.
25406312 2015 Progranulin and a five transmembrane domain-containing receptor-like gene are the key components in receptor activator of nuclear factor ?B (RANK)-dependent formation of multinucleated osteoclasts.
25377796 2015 Progranulin Deficiency Reduces CDK4/6/pRb Activation and Survival of Human Neuroblastoma SH-SY5Y Cells.
25365768 2015 Sortilin regulates progranulin action in castration-resistant prostate cancer cells.
25261445 2015 The novel GRN g.1159_1160delTG mutation is associated with behavioral variant frontotemporal dementia.
25231693 2014 Circulating progranulin level is associated with visceral fat and elevated liver enzymes: significance of serum progranulin as a useful marker for liver dysfunction.
25115442 2014 Granulin-epithelin precursor interacts with heparan sulfate on liver cancer cells.
25085782 2014 Defining the association of TMEM106B variants among frontotemporal lobar degeneration patients with GRN mutations and C9orf72 repeat expansions.
25056957 2014 Progranulin transcripts with short and long 5' untranslated regions (UTRs) are differentially expressed via posttranscriptional and translational repression.
25054309 2014 Serum adiponectin and progranulin levels are associated with gallstone disease.
25033727 2014 GP88 (progranulin): a novel tissue and circulating biomarker for non-small cell lung carcinoma.
25027814 2014 Progranulin shows cytoprotective effects on trophoblast cells in vitro but does not antagonize TNF-?-induced apoptosis.
25024321 2014 A mutation in the 5'-UTR of GRN gene associated with frontotemporal lobar degeneration: phenotypic variability and possible pathogenetic mechanisms.
24993774 2014 Early neuropsychological characteristics of progranulin mutation carriers.
24971611 2014 Circulating PGRN is significantly associated with systemic insulin sensitivity and autophagic activity in metabolic syndrome.
24899141 2014 Differential clinicopathologic and genetic features of late-onset amnestic dementias.
24896343 2014 Three TNFR-binding domains of PGRN act independently in inhibition of TNF-alpha binding and activity.
24878635 2014 Evidence of the innate antiviral and neuroprotective properties of progranulin.
24814951 2014 Clinical and MRI correlates of disease progression in a case of nonfluent/agrammatic variant of primary progressive aphasia due to progranulin (GRN) Cys157LysfsX97 mutation.
24803297 2014 Increased serum GP88 (Progranulin) concentrations in rheumatoid arthritis.
24800652 2014 Progranulin in neurodegenerative disease.
24793792 2015 Progranulin promotes Temozolomide resistance of glioblastoma by orchestrating DNA repair and tumor stemness.
24771538 2014 Progranulin protein levels are differently regulated in plasma and CSF.
24709683 2014 A novel GRN mutation (GRN c.708+6_+9delTGAG) in frontotemporal lobar degeneration with TDP-43-positive inclusions: clinicopathologic report of 6 cases.
24680777 2014 Progranulin polymorphism rs5848 is associated with increased risk of Alzheimer's disease.
24673545 2014 Serum levels of fractalkine are associated with markers of insulin resistance in gestational diabetes.
24652679 2014 Changes in matrix metalloprotease activity and progranulin levels may contribute to the pathophysiological function of mutant leucine-rich repeat kinase 2.
24591016 2014 Proinflammatory progranulin antibodies in inflammatory bowel diseases.
24503614 2014 Association of the variant Cys139Arg at GRN gene to the clinical spectrum of frontotemporal lobar degeneration.
24499389 2014 Progranulin gene variability influences the risk for bipolar I disorder, but not bipolar II disorder.
24494724 2014 Cortical degeneration in frontotemporal lobar degeneration with TDP-43 proteinopathy caused by progranulin gene mutation.
24449064 2014 Progranulin-associated PiB-negative logopenic primary progressive aphasia.
24417980 2014 Implications of C1q/TNF-related protein-3 (CTRP-3) and progranulin in patients with acute coronary syndrome and stable angina pectoris.
24387985 2014 Clinical and genetic analysis of MAPT, GRN, and C9orf72 genes in Korean patients with frontotemporal dementia.
24368088 2014 Understanding phenotype variability in frontotemporal lobar degeneration due to granulin mutation.
24343233 2014 Effect of TMEM106B polymorphism on functional network connectivity in asymptomatic GRN mutation carriers.
24309270 2014 Plasma phosphorylated TDP-43 levels are elevated in patients with frontotemporal dementia carrying a C9orf72 repeat expansion or a GRN mutation.
24286341 2014 A pathogenic progranulin mutation and C9orf72 repeat expansion in a family with frontotemporal dementia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24252750 2013 Expression of TMEM106B, the frontotemporal lobar degeneration-associated protein, in normal and diseased human brain.
24186875 2014 Progranulin is a substrate for neutrophil-elastase and proteinase-3 in the airway and its concentration correlates with mediators of airway inflammation in COPD.
24163244 2014 Targeted manipulation of the sortilin-progranulin axis rescues progranulin haploinsufficiency.
24139281 2014 PGRN haploinsufficiency increased Wnt5a signaling in peripheral cells from frontotemporal lobar degeneration-progranulin mutation carriers.
24120669 2014 Osteoblastic cell secretome: a novel role for progranulin during risedronate treatment.
24100384 Progranulin does not inhibit TNF and lymphotoxin-? signalling through TNF receptor 1.
24081456 2013 Development and validation of pedigree classification criteria for frontotemporal lobar degeneration.
24070898 2013 Progranulin directly binds to the CRD2 and CRD3 of TNFR extracellular domains.
24018267 2014 Secretory leukocyte protease inhibitor protein regulates the penetrance of frontotemporal lobar degeneration in progranulin mutation carriers.
24009671 2013 Progranulin is a novel independent predictor of disease progression and overall survival in chronic lymphocytic leukemia.
24005336 2013 Anterior brain glucose hypometabolism predates dementia in progranulin mutation carriers.
23847387 2013 Deletion of progranulin exacerbates atherosclerosis in ApoE knockout mice.
23702100 2013 Expression level of the growth factor progranulin is related with development of systemic lupus erythematosus.
23684369 2013 Screening for progranulin mutations by serum protein dosage in common neurodegenerative disorders.
23609919 2013 Progranulin mutations as risk factors for Alzheimer disease.
23596077 2013 Clinicopathologic variability of the GRN A9D mutation, including amyotrophic lateral sclerosis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23478307 2013 GRN Thr272fs clinical heterogeneity: a case with atypical late onset presenting with a dementia with Lewy bodies phenotype.
23476101 2013 Plasma progranulin concentrations are increased in patients with type 2 diabetes and obesity and correlated with insulin resistance.
23463024 2013 Novel progranulin mutations with reduced serum-progranulin levels in frontotemporal lobar degeneration.
23419701 2013 Molecular signature of disease onset in granulin mutation carriers: a gene expression analysis study.
23409033 2013 Implication of progranulin and C1q/TNF-related protein-3 (CTRP3) on inflammation and atherosclerosis in subjects with or without metabolic syndrome.
23398167 2013 Reduced serum progranulin level might be associated with Parkinson's disease risk.
23396349 2013 Gender effects on plasma PGRN levels in patients with Alzheimer's disease: a preliminary study.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23364791 2013 Secreted progranulin is a homodimer and is not a component of high density lipoproteins (HDL).
23342160 2013 Association between GRN rs5848 polymorphism and Parkinson's disease in Taiwanese population.
23338682 2013 Distinct clinical characteristics of C9orf72 expansion carriers compared with GRN, MAPT, and nonmutation carriers in a Flanders-Belgian FTLD cohort.
23317568 2013 Genetic study on frontotemporal lobar degeneration in India.
23236149 2012 Misregulation of human sortilin splicing leads to the generation of a nonfunctional progranulin receptor.
23218900 2013 Distinctive age-related temporal cortical thinning in asymptomatic granulin gene mutation carriers.
23158232 2012 Neuropsychological features of asymptomatic c.709-1G>A progranulin mutation carriers.
23140401 2012 Serum progranulin levels are elevated in patients with systemic lupus erythematosus, reflecting disease activity.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
22986778 2013 Structural brain signature of FTLD driven by Granulin mutation.
22945272 2012 Trophoblastic progranulin expression is upregulated in cases of fetal growth restriction and preeclampsia.
22890101 2013 Estimating the age of the most common Italian GRN mutation: walking back to Canossa times.
22890097 2013 GRN variant rs5848 reduces plasma and brain levels of granulin in Alzheimer's disease patients.
22859297 2012 Progranulin: a proteolytically processed protein at the crossroads of inflammation and neurodegeneration.
22819134 2012 Epidemiology and genetics of frontotemporal dementia: a door-to-door survey in southern Italy.
22802426 2012 Circulating progranulin levels in women with gestational diabetes mellitus and healthy controls during and after pregnancy.
22797721 2013 Progranulin gene (GRN) promoter methylation is increased in patients with sporadic frontotemporal lobar degeneration.
22792281 2012 Identification and characterization of tropomyosin 3 associated with granulin-epithelin precursor in human hepatocellular carcinoma.
22787763 2011 [Progranulin].
22761921 2012 Progranulin as a prognostic biomarker for breast cancer recurrence in patients who had hormone receptor-positive tumors: a cohort study.
22665040 2012 PKC signaling is involved in the regulation of progranulin (acrogranin/PC-cell-derived growth factor/granulin-epithelin precursor) protein expression in human ovarian cancer cell lines.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22647257 2012 Serum progranulin levels in patients with frontotemporal lobar degeneration and Alzheimer's disease: detection of GRN mutations in a Spanish cohort.
22623979 2012 Inactivation of CDK/pRb pathway normalizes survival pattern of lymphoblasts expressing the FTLD-progranulin mutation c.709-1G>A.
22608501 2012 Strikingly different clinicopathological phenotypes determined by progranulin-mutation dosage.
22509390 2012 Regulation of progranulin expression in human microglia and proteolysis of progranulin by matrix metalloproteinase-12 (MMP-12).
22505994 2012 Progranulin gene variability and plasma levels in bipolar disorder and schizophrenia.
22504418 2012 Common variants at 6q22 and 17q21 are associated with intracranial volume.
22491866 2012 Similar clinical and neuroimaging features in monozygotic twin pair with mutation in progranulin.
22397762 2012 Progranulin expression in breast cancer with different intrinsic subtypes.
22366795 2012 Neuroimaging signatures of frontotemporal dementia genetics: C9ORF72, tau, progranulin and sporadics.
22348647 2012 Losing protein in the brain: the case of progranulin.
22338605 2012 Progranulin: an emerging target for FTLD therapies.
22316048 2012 Progranulin (GP88) tumor tissue expression is associated with increased risk of recurrence in breast cancer patients diagnosed with estrogen receptor positive invasive ductal carcinoma.
22280948 2012 Intrafamilial clinical phenotypic heterogeneity with progranulin gene p.Glu498fs mutation.
22204653 2012 Mining the gastric cancer secretome: identification of GRN as a potential diagnostic marker for early gastric cancer.
22194816 2011 Granulin-epithelin precursor is an oncofetal protein defining hepatic cancer stem cells.
22176685 2011 Progranulin stimulated by LPA promotes the migration of aggressive breast cancer cells.
22130207 2012 Granulin mutation drives brain damage and reorganization from preclinical to symptomatic FTLD.
22127750 2012 Prevalence of frontotemporal lobar degeneration in an isolated population: the Vallecamonica study.
22088468 2011 Clinicopathologic and prognostic implications of progranulin in breast carcinoma.
22068162 2012 Interleukin-6-driven progranulin expression increases cholangiocarcinoma growth by an Akt-dependent mechanism.
22045426 2011 Serum progranulin as an independent marker of liver fibrosis in patients with biopsy-proven nonalcoholic fatty liver disease.
22032330 2011 Altered microRNA expression in frontotemporal lobar degeneration with TDP-43 pathology caused by progranulin mutations.
21892962 2011 Low plasma progranulin levels in children with autism.
21891869 2011 From genotype to phenotype: two cases of genetic frontotemporal lobar degeneration with premorbid bipolar disorder.
21891865 2011 Cerebrospinal fluid biomarkers in Progranulin mutations carriers.
21813674 2011 Progranulin deficiency decreases gross neural connectivity but enhances transmission at individual synapses.
21802097 2011 Increased progranulin in the skin of amyotrophic lateral sclerosis: an immunohistochemical study.
21800185 2012 Progranulin genetic screening in frontotemporal lobar degeneration patients from central Italy.
21753165 2011 Trajectories of brain and hippocampal atrophy in FTD with mutations in MAPT or GRN.
21707777 2011 Upregulation of progranulin by Helicobacter pylori in human gastric epithelial cells via p38MAPK and MEK1/2 signaling pathway: role in epithelial cell proliferation and migration.
21677378 2011 Variability of the clinical phenotype in an Italian family with dementia associated with an intronic deletion in the GRN gene.
21645364 2011 Loss of function mutations in the progranulin gene are related to pro-inflammatory cytokine dysregulation in frontotemporal lobar degeneration patients.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21482928 2011 Genetic and clinical features of progranulin-associated frontotemporal lobar degeneration.
21454553 2011 Suberoylanilide hydroxamic acid (vorinostat) up-regulates progranulin transcription: rational therapeutic approach to frontotemporal dementia.
21393509 2011 The growth factor progranulin binds to TNF receptors and is therapeutic against inflammatory arthritis in mice.
21289198 2011 Rescue of progranulin deficiency associated with frontotemporal lobar degeneration by alkalizing reagents and inhibition of vacuolar ATPase.
21263192 2010 Evaluation of urinary proepithelin as a potential biomarker for bladder cancer detection and prognosis in Egyptian patients.
21258152 2011 Phenotypic heterogeneity of the GRN Asp22fs mutation in a large Italian kindred.
21232819 2012 Alteration in cell cycle-related proteins in lymphoblasts from carriers of the c.709-1G>A PGRN mutation associated with FTLD-TDP dementia.
21224065 2011 Progranulin is a chemoattractant for microglia and stimulates their endocytic activity.
21212639 2011 rs5848 variant of progranulin gene is a risk of Alzheimer's disease in the Taiwanese population.
21204008 2010 Progranulin promotes neurite outgrowth and neuronal differentiation by regulating GSK-3?.
21178100 2011 TMEM106B regulates progranulin levels and the penetrance of FTLD in GRN mutation carriers.
21123963 2011 Expression pattern of progranulin in the human placenta and its effect on cell proliferation in the choriocarcinoma cell line BeWo.
21107132 2010 Microglial upregulation of progranulin as a marker of motor neuron degeneration.
21087763 2010 Genome-wide screen identifies rs646776 near sortilin as a regulator of progranulin levels in human plasma.
21085476 2010 Adipokine pattern in subjects with impaired fasting glucose and impaired glucose tolerance in comparison to normal glucose tolerance and diabetes.
21078624 2011 Comparison of an expanded ataxia interactome with patient medical records reveals a relationship between macular degeneration and ataxia.
21047645 2011 rs5848 polymorphism and serum progranulin level.
20975516 Novel progranulin mutation detected in 2 patients with FTLD.
20947212 2011 Founder effect and estimation of the age of the Progranulin Thr272fs mutation in 14 Italian pedigrees with frontotemporal lobar degeneration.
20933034 2010 Hypoxia induces up-regulation of progranulin in neuroblastoma cell lines.
20930271 2011 A novel progranulin mutation causing frontotemporal lobar degeneration with heterogeneous phenotypic expression.
20930269 2010 Intra-familial clinical heterogeneity due to FTLD-U with TDP-43 proteinopathy caused by a novel deletion in progranulin gene (PGRN).
20884628 2010 Dysregulation of the mitogen granulin in human cancer through the miR-15/107 microRNA gene group.
20858962 2010 Low serum progranulin predicts the presence of mutations: a prospective study.
20798611 Progranulin mutations are a common cause of FTLD in Northern Italy.
20711061 Prion protein codon 129 polymorphism modifies age at onset of frontotemporal dementia with the C.709-1G>A progranulin mutation.
20682318 2011 Granulin-epithelin precursor and ATP-dependent binding cassette (ABC)B5 regulate liver cancer cell chemoresistance.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20570546 2010 Familial frontotemporal dementia with parkinsonism associated with the progranulin c.C1021T (p.Q341X) mutation.
20489155 2010 miR-107 regulates granulin/progranulin with implications for traumatic brain injury and neurodegenerative disease.
20479936 2010 MicroRNA-29b regulates the expression level of human progranulin, a secreted glycoprotein implicated in frontotemporal dementia.
20463744 2010 Progranulin gene variability increases the risk for primary progressive multiple sclerosis in males.
20387302 2010 Role of progranulin as a biomarker for Alzheimer's disease.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20215705 2010 HDL/apolipoprotein A-I binds to macrophage-derived progranulin and suppresses its conversion into proinflammatory granulins.
20197700 2010 Common variant in GRN is a genetic risk factor for hippocampal sclerosis in the elderly.
20188224 2010 Development and application of mass spectrometric methods for the analysis of progranulin N-glycosylation.
20171924 2010 Screening for MAPT and PGRN mutations in Korean patients with PSP/CBS/FTD.
20154673 2010 Common variants at 7p21 are associated with frontotemporal lobar degeneration with TDP-43 inclusions.
20142525 2010 Alzheimer disease-like phenotype associated with the c.154delA mutation in progranulin.
20142524 2010 The spectrum of mutations in progranulin: a collaborative study screening 545 cases of neurodegeneration.
20087814 2010 Progranulin (GRN) in two siblings of a Latino family and in other patients with schizophrenia.
20061636 2010 GRN variability contributes to sporadic frontotemporal lobar degeneration.
20054825 2010 Progranulin (granulin/epithelin precursor) and its constituent granulin repeats repress transcription from cellular promoters.
20045477 2010 Distinct profiles of brain atrophy in frontotemporal lobar degeneration caused by progranulin and tau mutations.
20028451 2010 Pathogenic cysteine mutations affect progranulin function and production of mature granulins.
20020531 2010 A thorough assessment of benign genetic variability in GRN and MAPT.
19963041 2010 Cerebrospinal fluid progranulin levels in patients with different multiple sclerosis subtypes.
19940479 2009 No evidence of PGRN or MAPT gene dosage alterations in a collection of patients with frontotemporal lobar degeneration.
19938685 2009 [Clinical, pathological, and genetic characteristics of frontotemporal dementia and parkinsonism linked to chromosome 17 with mutations in the MAPT and PGRN].
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19864668 2009 Corticobasal syndrome associated with a novel 1048_1049insG progranulin mutation.
19863344 2010 Expression of progranulin (Acrogranin/PCDGF/Granulin-Epithelin Precursor) in benign and malignant ovarian tumors and activation of MAPK signaling in ovarian cancer cell line.
19858458 2009 "Frontotemporoparietal" dementia: clinical phenotype associated with the c.709-1G>A PGRN mutation.
19847305 2009 Variation at GRN 3'-UTR rs5848 is not associated with a risk of frontotemporal lobar degeneration in Dutch population.
19795409 2009 The granulin gene family: from cancer to dementia.
19730171 Higher than expected progranulin mutation rate in a case series of Italian FTLD patients.
19730170 PGRN mutations in northern Italy.
19649643 2010 Brain progranulin expression in GRN-associated frontotemporal lobar degeneration.
19632744 2011 No major progranulin genetic variability contribution to disease etiopathogenesis in an ALS Italian cohort.
19625741 2009 Rs5848 variant influences GRN mRNA levels in brain and peripheral mononuclear cells in patients with Alzheimer's disease.
19618231 2009 Frequency of progranulin mutations in a German cohort of 79 frontotemporal dementia patients.
19487464 2009 ADAMTS-7, a direct target of PTHrP, adversely regulates endochondral bone growth by associating with and inactivating GEP growth factor.
19473366 2009 GRN 3'UTR+78 C>T is not associated with risk for Parkinson's disease.
19446372 2011 No association of PGRN 3'UTR rs5848 in frontotemporal lobar degeneration.
19321167 2009 Progranulin expression in advanced human atherosclerotic plaque.
19255408 2009 Voxel-based morphometry patterns of atrophy in FTLD with mutations in MAPT or PGRN.
19237611 2009 Proepithelin is an autocrine growth factor for bladder cancer.
19179604 2009 Proepithelin regulates prostate cancer cell biology by promoting cell growth, migration, and anchorage-independent growth.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19158106 2009 Plasma progranulin levels predict progranulin mutation status in frontotemporal dementia patients and asymptomatic family members.
19133655 2009 Parkinsonism and impulse control disorder: presentation of a new progranulin gene mutation.
19101631 2009 Progranulin Leu271LeufsX10 is one of the most common FTLD and CBS associated mutations worldwide.
19091059 2008 Role of MAPT mutations and haplotype in frontotemporal lobar degeneration in Northern Finland.
19056610 2009 Serum progranulin concentrations may be associated with macrophage infiltration into omental adipose tissue.
19049508 2009 Low prevalence of progranulin mutations in Finnish patients with frontotemporal lobar degeneration.
19020205 2009 Cortical atrophy and language network reorganization associated with a novel progranulin mutation.
19016491 2009 An association study between granulin gene polymorphisms and Alzheimer's disease in Finnish population.
19012866 2008 Progranulin mutation causes frontotemporal dementia in the Swedish Karolinska family.
18955727 Association between progranulin and beta-amyloid in dementia with Lewy bodies.
18855025 2009 Frontotemporal dementia in a large Swedish family is caused by a progranulin null mutation.
18848708 2009 Progranulin (PGRN) expression in ALS: an immunohistochemical study.
18838661 2008 Progranulin variability has no major role in Parkinson disease genetic etiology.
18771956 2008 Mutations in progranulin (GRN) within the spectrum of clinical and pathological phenotypes of frontotemporal dementia.
18768919 2008 Low plasma progranulin levels predict progranulin mutations in frontotemporal lobar degeneration.
18752597 2008 Novel exon 1 progranulin gene variant in Alzheimer's disease.
18723524 2008 Common variation in the miR-659 binding-site of GRN is a major risk factor for TDP43-positive frontotemporal dementia.
18723384 2009 Pallidonigral TDP-43 pathology in Perry syndrome.
18706200 2008 Expression of PC cell-derived growth factor and vascular endothelial growth factor in esophageal squamous cell carcinoma and their clinicopathologic significance.
18593276 2008 Brain magnetic resonance imaging structural changes in a pedigree of asymptomatic progranulin mutation carriers.
18565828 2008 Genetic variability in progranulin contributes to risk for clinically diagnosed Alzheimer disease.
18551524 2008 Gene expression study on peripheral blood identifies progranulin mutations.
18543312 2008 Granulin mutations associated with frontotemporal lobar degeneration and related disorders: an update.
18479928 2008 Deletion of the progranulin gene in patients with frontotemporal lobar degeneration or Parkinson disease.
18464284 2008 Novel progranulin mutation: screening for PGRN mutations in a Portuguese series of FTD/CBS cases.
18442119 2008 Progranulin gene mutation with an unusual clinical and neuropathologic presentation.
18413474 2008 Parietal lobe deficits in frontotemporal lobar degeneration caused by a mutation in the progranulin gene.
18413467 2008 Refining frontotemporal dementia with parkinsonism linked to chromosome 17: introducing FTDP-17 (MAPT) and FTDP-17 (PGRN).
18392865 2008 Progranulin genetic variations in frontotemporal lobar degeneration: evidence for low mutation frequency in an Italian clinical series.
18378771 2008 Progranulin functions as a neurotrophic factor to regulate neurite outgrowth and enhance neuronal survival.
18359860 2008 Structure dissection of human progranulin identifies well-folded granulin/epithelin modules with unique functional activities.
18322394 2008 In vivo and postmortem clinicoanatomical correlations in frontotemporal dementia and parkinsonism linked to chromosome 17.
18314228 2009 Novel PSEN1 and PGRN mutations in early-onset familial frontotemporal dementia.
18245784 2008 Phenotype variability in progranulin mutation carriers: a clinical, neuropsychological, imaging and genetic study.
18234697 2008 A distinct clinical, neuropsychological and radiological phenotype is associated with progranulin gene mutations in a large UK series.
18223198 2008 Variations in the progranulin gene affect global gene expression in frontotemporal lobar degeneration.
18192287 2008 Frequency and clinical characteristics of progranulin mutation carriers in the Manchester frontotemporal lobar degeneration cohort: comparison with patients with MAPT and no known mutations.
18184915 2008 Progranulin genetic variability contributes to amyotrophic lateral sclerosis.
18183624 2008 Molecular characterization of novel progranulin (GRN) mutations in frontotemporal dementia.
18166610 New genes, new dilemmas: FTLD genetics and its implications for families.
18157829 2008 Progranulin locus deletion in frontotemporal dementia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17984093 2008 Missense mutations in the progranulin gene linked to frontotemporal lobar degeneration with ubiquitin-immunoreactive inclusions reduce progranulin production and secretion.
17950702 2008 Mutations in progranulin gene: clinical, pathological, and ribonucleic acid expression findings.
17949857 2009 Prominent phenotypic variability associated with mutations in Progranulin.
17826340 2007 Phenotypic variability associated with progranulin haploinsufficiency in patients with the common 1477C-->T (Arg493X) mutation: an international initiative.
17698705 2007 Clinical, genetic, and pathologic characteristics of patients with frontotemporal dementia and progranulin mutations.
17620546 2007 Heterogeneity within a large kindred with frontotemporal dementia: a novel progranulin mutation.
17572900 2007 Progranulin and frontotemporal lobar degeneration.
17522386 2007 Clinicopathologic correlation in PGRN mutations.
17458552 2007 The neuropathology and clinical phenotype of FTD with progranulin mutations.
17439980 2007 A novel progranulin mutation associated with variable clinical presentation and tau, TDP43 and alpha-synuclein pathology.
17436289 2007 Progranulin null mutations in both sporadic and familial frontotemporal dementia.
17417739 2007 Late-onset frontotemporal dementia associated with a novel PGRN mutation.
17383054 2008 Genetic studies of GRN and IFT74 in amyotrophic lateral sclerosis.
17371905 2007 Progranulin mutations and amyotrophic lateral sclerosis or amyotrophic lateral sclerosis-frontotemporal dementia phenotypes.
17353379 2007 Voxel-based morphometry in frontotemporal lobar degeneration with ubiquitin-positive inclusions with and without progranulin mutations.
17345602 2007 Mutations other than null mutations producing a pathogenic loss of progranulin in frontotemporal dementia.
17291356 2007 Progranulin in frontotemporal lobar degeneration and neuroinflammation.
17278999 2007 Neuropathologic features of frontotemporal lobar degeneration with ubiquitin-positive inclusions with progranulin gene (PGRN) mutations.
17266030 2007 Prosurvival function of the granulin-epithelin precursor is important in tumor progression and chemoresponse.
17261172 2007 Inhibition of PC cell-derived growth factor (PCDGF)/granulin-epithelin precursor (GEP) decreased cell proliferation and invasion through downregulation of cyclin D and CDK4 and inactivation of MMP-2.
17228326 2007 Progranulin mutations in Dutch familial frontotemporal lobar degeneration.
17210807 2007 Progranulin mutations in primary progressive aphasia: the PPA1 and PPA3 families.
17202431 2007 Clinicopathologic features of frontotemporal dementia with progranulin sequence variation.
17166276 2006 Analysis of IFT74 as a candidate gene for chromosome 9p-linked ALS-FTD.
17157414 2008 A novel deletion in progranulin gene is associated with FTDP-17 and CBS.
16983685 2006 HDDD2 is a familial frontotemporal lobar degeneration with ubiquitin-positive, tau-negative inclusions caused by a missense mutation in the signal peptide of progranulin.
16983677 2006 Characteristics of frontotemporal dementia patients with a Progranulin mutation.
16950801 2006 Mutations in progranulin are a major cause of ubiquitin-positive frontotemporal lobar degeneration.
16862116 2006 Mutations in progranulin cause tau-negative frontotemporal dementia linked to chromosome 17.
16862115 2006 Null mutations in progranulin cause ubiquitin-positive frontotemporal dementia linked to chromosome 17q21.
16857791 2006 PC cell-derived growth factor stimulates proliferation and confers Trastuzumab resistance to Her-2-overexpressing breast cancer cells.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16533762 2006 Oncogenic property of acrogranin in human uterine leiomyosarcoma: direct evidence of genetic contribution in in vivo tumorigenesis.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15653695 2005 Granulin and granulin repeats interact with the Tat.P-TEFb complex and inhibit Tat transactivation.
15569995 2004 Granulin-epithelin precursor overexpression promotes growth and invasion of hepatocellular carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14977833 2004 PC cell-derived growth factor expression in prostatic intraepithelial neoplasia and prostatic adenocarcinoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14652816 2003 Expression of PC-cell-derived growth factor in benign and malignant human breast epithelium.
12931033 2003 The Tat protein of the caprine arthritis encephalitis virus interacts with the Notch2 EGF-like repeats and the epithelin/granulin precursor.
12914763 2003 Autocrine growth factor revisited: PC-cell-derived growth factor (progranulin), a critical player in breast cancer tumorigenesis.
12900424 2003 A novel interaction between perlecan protein core and progranulin: potential effects on tumor growth.
12588988 2003 The growth factor granulin interacts with cyclin T1 and modulates P-TEFb-dependent transcription.
12538450 2003 The granulin-epithelin precursor/PC-cell-derived growth factor is a growth factor for epithelial ovarian cancer.
12526812 2002 Conversion of proepithelin to epithelins: roles of SLPI and elastase in host defense and wound repair.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12031912 2002 Overexpression of translocation-associated fusion genes of FGFRI, MYC, NPMI, and DEK, but absence of the translocations in acute myeloid leukemia. A microarray analysis.
11846389 2002 The EGF-like homeotic protein dlk affects cell growth and interacts with growth-modulating molecules in the yeast two-hybrid system.
11549288 2001 M phase-specific association of human topoisomerase IIIbeta with chromosomes.
11068878 2000 Interaction of insulin-like growth factor binding protein-4, Miz-1, leptin, lipocalin-type prostaglandin D synthase, and granulin precursor with the N-terminal half of type III hexokinase.
10728698 2000 Identification of a human glioma-associated growth factor gene, granulin, using differential immuno-absorption.
10715107 2000 Design and solution structure of a well-folded stack of two beta-hairpins based on the amino-terminal fragment of human granulin A.
10477733 1999 The human platelet alphaIIb gene is not closely linked to its integrin partner beta3.
10397269 1999 Progranulin gene expression regulates epithelial cell growth and promotes tumor growth in vivo.
10079180 1999 Epithelin/granulin growth factors: extracellular cofactors for HIV-1 and HIV-2 Tat proteins.
9826678 1998 Inhibition of tumorigenicity of the teratoma PC cell line by transfection with antisense cDNA for PC cell-derived growth factor (PCDGF, epithelin/granulin precursor).
9110174 1997 Large-scale concatenation cDNA sequencing.
8912679 1996 Structural and functional analysis of a promoter of the human granulin/epithelin gene.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8496151 1993 Purification of an autocrine growth factor homologous with mouse epithelin precursor from a highly tumorigenic cell line.
8471426 1993 Characterisation of UGP and its relationship with beta-core fragment.
8471244 1993 Acrogranin, an acrosomal cysteine-rich glycoprotein, is the precursor of the growth-modulating peptides, granulins, and epithelins, and is expressed in somatic as well as male germ cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2268320 1990 Granulins, a novel class of peptide from leukocytes.
1618805 1992 The epithelin precursor encodes two proteins with opposing activities on epithelial cell growth.
1542665 1992 Isolation and sequence of the granulin precursor cDNA from human bone marrow reveals tandem cysteine-rich granulin domains.
1417868 1992 Structure and chromosomal location of the human granulin gene.