Property Summary

NCBI Gene PubMed Count 371
PubMed Score 1139.78
PubTator Score 940.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Aphasia 26
Mutism 17
Echolalia 12
Abnormal brain FDG positron emission tomography 9
Aggressive behavior 75
Aggressive reaction 75
Agitation 16
Alexia 6
Anxiety 136
Anxiety disease 113
Apathy 16
Apraxias 27
Atrophy of cerebellum 103
Autosomal recessive predisposition 1442
Bipolar Disorder 666
Cerebellar Ataxia 304
Cerebellar degeneration 103
Cerebral atrophy 178
Compulsive hoarding 7
Cortical white matter abnormalities seen on MRI 18
Depressive disorder 409
Developmental arithmetic disorder 8
Difficulty making arithmetical calculations 8
Dilation of lateral ventricles 4
Dysgraphia 20
Dyslexia 43
Dysphasia 23
EEG with continuous slow activity 7
Electroencephalogram abnormal 101
Epilepsies, Myoclonic 32
Excess nuchal skin 30
Forgetful 40
Frontotemporal cerebral atrophy 8
Generalized myoclonic seizures 30
Gliosis 56
Grammar-specific speech disorder 6
Hallucinations 34
Hallucinations, Sensory 33
Hyperorality 7
Hyperphagia 23
Hypersexuality state 2
Increased appetite (finding) 23
Infratentorial atrophy 103
Irritation - emotion 68
Leukoaraiosis 18
Loss of speech 16
Low Vision 174
Memory Loss 40
Memory impairment 40
Mental Depression 333
Myoclonic Epilepsies, Progressive 44
Neuronal loss 25
Optic Atrophy 242
Parkinsonian Disorders 56
Personality change 23
Physical aggression 76
Poor speech 37
Primary Progressive Nonfluent Aphasia 7
Problems speaking 37
Progressive language deterioration 2
Rapidly progressive 27
Rapidly progressive disorder 27
Repeated speech 9
Repetitive compulsive behavior 1
Restlessness 14
Restrictive behavior 7
Restrictive behavior, interests, and activities 7
Retinal Dystrophies 33
Schizophrenia 1160
Semantic Dementia 7
Social disinhibition 14
Spoken Word Recognition Deficit 6
Stereotyped Behavior 37
Stereotypic Movement Disorder 42
Temporal cortical atrophy 6
Visual Impairment 174
sexual addiction 2
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Neuronal ceroid lipofuscinosis 28 3.94 2.0
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 1.200 5.9e-03
Astrocytoma, Pilocytic 1.100 1.1e-07
atypical teratoid / rhabdoid tumor 1.300 5.5e-05
diabetes mellitus -1.100 1.3e-02
Duchenne muscular dystrophy 1.013 7.6e-10
ependymoma 1.200 6.4e-03
glioblastoma 1.500 4.2e-03
invasive ductal carcinoma 1.320 5.8e-04
juvenile dermatomyositis 1.071 2.8e-09
lung carcinoma -1.400 2.3e-18
mucosa-associated lymphoid tissue lympho... 1.131 2.8e-02
non primary Sjogren syndrome sicca 1.100 4.4e-02
oligodendroglioma 1.200 4.8e-03
ovarian cancer -1.100 9.1e-05
pediatric high grade glioma 1.200 9.3e-04
psoriasis 2.400 1.5e-05
tuberculosis 1.200 4.0e-06

 GWAS Trait (1)

Protein-protein Interaction (10)

Gene RIF (363)

AA Sequence

MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAG      1 - 70
HSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCC     71 - 140
VMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPD    141 - 210
ARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVG    211 - 280
DVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPA    281 - 350
HLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGS    351 - 420
EIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNV    421 - 490
KARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCP    491 - 560
AGFRCAARGTKCLRREAPRWDAPLRDPALRQLL                                         561 - 593
//

Text Mined References (372)

PMID Year Title