Property Summary

Ligand Count 19
NCBI Gene PubMed Count 22
PubMed Score 92.30
PubTator Score 22.76

Knowledge Summary

Patent (5,257)


  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.100 9.8e-04
psoriasis -1.700 1.2e-22

 GWAS Trait (1)

Gene RIF (19)

AA Sequence

YVILFHPEQNVQKRKRSLKATSTVAAPPKGEDAEAHK                                     841 - 877

Text Mined References (24)

PMID Year Title