Property Summary

Ligand Count 44
NCBI Gene PubMed Count 39
PubMed Score 217.24
PubTator Score 28.00

Knowledge Summary

Patent (15,844)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Epilepsy, Temporal Lobe 23 0.0 0.0
Nerve Degeneration 121 0.0 0.0
Disease Target Count P-value
adult high grade glioma 3801 8.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Liver cancer 604 0.0 0.5
Disease Target Count Z-score Confidence
osteosarcoma 7950 0.0 3.0
Disease Target Count Z-score Confidence
Parkinson's disease 392 4.718 2.4
Epilepsy 792 3.37 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
adult high grade glioma -1.100 8.8e-03

Gene RIF (24)

AA Sequence

MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGRGSEGKPCGEL      1 - 70
KKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSLTFVQALIEKDGTEVRCGSGG     71 - 140
PPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYASTAPDLSDNSRYDFFSRVVPSDTYQAQAMV    141 - 210
DIVRALKWNYVSTVASEGSYGESGVEAFIQKSREDGGVCIAQSVKIPREPKAGEFDKIIRRLLETSNARA    211 - 280
VIIFANEDDIRRVLEAARRANQTGHFFWMGSDSWGSKIAPVLHLEEVAEGAVTILPKRMSVRGFDRYFSS    281 - 350
RTLDNNRRNIWFAEFWEDNFHCKLSRHALKKGSHVKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL    351 - 420
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQYQLRNDSAEYK    421 - 490
VIGSWTDHLHLRIERMHWPGSGQQLPRSICSLPCQPGERKKTVKGMPCCWHCEPCTGYQYQVDRYTCKTC    491 - 560
PYDMRPTENRTGCRPIPIIKLEWGSPWAVLPLFLAVVGIAATLFVVITFVRYNDTPIVKASGRELSYVLL    561 - 630
AGIFLCYATTFLMIAEPDLGTCSLRRIFLGLGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQL    631 - 700
AITFSLISLQLLGICVWFVVDPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVY    701 - 770
AIKTRGVPETFNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP    771 - 840
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLEAPALATKQTYVTYTNH    841 - 910
AI                                                                        911 - 912
//

Text Mined References (39)

PMID Year Title