Property Summary

NCBI Gene PubMed Count 37
PubMed Score 207.43
PubTator Score 28.00

Knowledge Summary

Patent (15,844)

TINX Plot

  Disease (5)

Disease Target Count P-value
adult high grade glioma 2148 8.8e-03
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
osteosarcoma 7933 0.0 2.0
Disease Target Count Z-score Confidence
Parkinson's disease 364 4.723 2.4
Schizophrenia 503 3.842 1.9
Epilepsy 346 3.242 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
adult high grade glioma -1.100 8.8e-03

Protein-protein Interaction (182)

GNAT3   GRM8   F2RL2   P2RY10   CCL21   CXCL11   NPFF   GRM6   CCL25   CCL16   MLNR   HCRT   HCRTR1   HCRTR2   CXCL13   S1PR2   UTS2   NTSR2   S1PR4   F2   OXT   AVP   PENK   PDYN   PPY   NPY   PPBP   PF4   CXCL10   APP   NMB   NPS   SAA1   ADORA3   PYY   CXCL8   MLN   CCL5   ADRA2C   CXCL2   CXCL3   TAC1   PMCH   TRH   TACR2   TBXA2R   TACR1   PTAFR   ACKR3   F2R   NPY1R   HTR2C   NMBR   TACR3   OXTR   SSTR1   SSTR2   NTSR1   NTS   SSTR4   CXCR5   SSTR3   TRHR   PTGER1   SSTR5   OPRM1   AVPR1A   OPRD1   OPRK1   OPRL1   P2RY2   GRM5   CCR2   CXCL5   PTGFR   PTGER3   LPAR6   P2RY1   AVPR1B   XCL1   MTNR1A   CXCL12   NMU   PIK3CG   NPY2R   MTNR1B   CXCR3   NPY4R   P2RY4   CCR9   F2RL1   CCL23   PROK1   TAS2R38   TAS2R39   TAS2R40   TAS2R41   TAS2R43   TAS2R31   TAS2R45   TAS2R46   TAS2R30   TAS2R19   TAS2R20   TAS2R50   TAS2R60   GNG2   CXCR4   SST   CCL20   CXCL6   QRFP   PLCB2   PLCB3   CXCL9   PNOC   GRM7   P2RY6   P2RY14   NPY5R   NMS   GPRC6A   PIK3R6   NPSR1   UTS2B   TAS2R42   MT-RNR2   GPR65   NPW   PROKR2   NPB   PROKR1   HCAR2   OXER1   RXFP4   RLN3   PIK3R5   ARHGEF1   KISS1R   MCHR2   P2RY11   QRFPR   OXGR1   F2RL3   LPAR4   CCL19   P2RY13   SUCNR1   HCAR1   NMUR2   NPFFR1   LPAR5   S1PR5   P2RY12   CXCL16   NMUR1   PROK2   PLCB1   CCL28   HEBP1   RXFP3   TAS2R16   TAS2R14   TAS2R13   TAS2R10   TAS2R9   TAS2R8   TAS2R7   TAS2R5   TAS2R4   TAS2R3   TAS2R1   ARHGEF12   XCL2   GHRL   TAC3   OPN4   UTS2R   GPR132   GPR55   CCL27   NPFFR2  

Gene RIF (22)

PMID Text
25613138 The gene expression of GRM4 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25342125 explored the relationship between the binding pockets of mGlu4-positive allosteric modulators with different chemical scaffolds and their functional properties
24984297 The GRM4 gene polymorphism was associated with the susceptibility and metastasis of osteosarcoma in a Chinese Han population.
24925192 The major depression subjects exhibited significantly higher expression level in the metabotropic receptor genes GRM4 in Locus coeruleus neurons.
24840839 study found that only one of the five SNPs tested showed a moderate but statistically significant association with juvenile myoclonic epilepsy in an Indian population
20859245 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20826542 Data show that mGlu2 and mGlu4 subunits (but not mGlu2 and mGlu1) can heteromerize.
20338729 GRM4 sequence variants might confer low-risk effects to the etiology of idiopathic generalized epilepsies.
20338729 Observational study of gene-disease association. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19351574 Observational study of gene-disease association. (HuGE Navigator)
19328558 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
17884634 the effects of P-Ser (inhibition of neural stem cell proliferation and self-renewal, enhanced neurogenic fate commitment, and improved neuronal survival) are mediated bymGluR4.
16899734 These data suggest that mGlu4 receptor enhancers are promising drugs for the treatment of medulloblastomas.
16582932 mGluR4 internalization and desensitization are agonist-independent unless pathways leading to the activation of PKC are induced.
16380905 Observational study of gene-disease association. (HuGE Navigator)
15867225 Results suggest that overexpression of mGluR4 is associated with poor prognosis.
15217955 mGluR4 has a role in 5-FU resistance in colonic neoplasms
15184361 residues shaping the binding pocket determine ligand selectivity for mGLUR4
11525421 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGRGSEGKPCGEL      1 - 70
KKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSLTFVQALIEKDGTEVRCGSGG     71 - 140
PPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYASTAPDLSDNSRYDFFSRVVPSDTYQAQAMV    141 - 210
DIVRALKWNYVSTVASEGSYGESGVEAFIQKSREDGGVCIAQSVKIPREPKAGEFDKIIRRLLETSNARA    211 - 280
VIIFANEDDIRRVLEAARRANQTGHFFWMGSDSWGSKIAPVLHLEEVAEGAVTILPKRMSVRGFDRYFSS    281 - 350
RTLDNNRRNIWFAEFWEDNFHCKLSRHALKKGSHVKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL    351 - 420
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQYQLRNDSAEYK    421 - 490
VIGSWTDHLHLRIERMHWPGSGQQLPRSICSLPCQPGERKKTVKGMPCCWHCEPCTGYQYQVDRYTCKTC    491 - 560
PYDMRPTENRTGCRPIPIIKLEWGSPWAVLPLFLAVVGIAATLFVVITFVRYNDTPIVKASGRELSYVLL    561 - 630
AGIFLCYATTFLMIAEPDLGTCSLRRIFLGLGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQL    631 - 700
AITFSLISLQLLGICVWFVVDPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVY    701 - 770
AIKTRGVPETFNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP    771 - 840
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLEAPALATKQTYVTYTNH    841 - 910
AI                                                                        911 - 912
//

Text Mined References (37)

PMID Year Title
25342125 2015 Overlapping binding sites drive allosteric agonism and positive cooperativity in type 4 metabotropic glutamate receptors.
24984297 2014 GRM4 gene polymorphism is associated with susceptibility and prognosis of osteosarcoma in a Chinese Han population.
24925192 2014 Elevated gene expression of glutamate receptors in noradrenergic neurons from the locus coeruleus in major depression.
24840839 2014 Association of the GRM4 gene variants with juvenile myoclonic epilepsy in an Indian population.
23727862 2013 Genome-wide association study identifies two susceptibility loci for osteosarcoma.
20859245 2011 Glutamatergic gene variants impact the clinical profile of efficacy and side effects of haloperidol.
20826542 2011 A new approach to analyze cell surface protein complexes reveals specific heterodimeric metabotropic glutamate receptors.
20338729 2010 Role of GRM4 in idiopathic generalized epilepsies analysed by genetic association and sequence analysis.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19351574 2009 Association study of polymorphisms in the group III metabotropic glutamate receptor genes, GRM4 and GRM7, with schizophrenia.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
17884634 2007 A phenotypic small-molecule screen identifies an orphan ligand-receptor pair that regulates neural stem cell differentiation.
16899734 2006 Pharmacological activation of mGlu4 metabotropic glutamate receptors inhibits the growth of medulloblastomas.
16582932 2006 The metabotropic glutamate receptor 4 is internalized and desensitized upon protein kinase C activation.
16380905 2005 Bipolar I disorder and schizophrenia: a 440-single-nucleotide polymorphism screen of 64 candidate genes among Ashkenazi Jewish case-parent trios.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15867225 2005 Metabotropic glutamate receptor 4 expression in colorectal carcinoma and its prognostic significance.
15217955 2004 Metabotropic glutamate receptor 4-mediated 5-Fluorouracil resistance in a human colon cancer cell line.
15184361 2004 Mutation-induced quisqualic acid and ibotenic acid affinity at the metabotropic glutamate receptor subtype 4: ligand selectivity results from a synergy of several amino acid residues.
15102938 2004 Regulation of mGlu4 metabotropic glutamate receptor signaling by type-2 G-protein coupled receptor kinase (GRK2).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11943148 2002 The actin-binding protein Filamin-A interacts with the metabotropic glutamate receptor type 7.
11847215 2002 Neutrophil-derived glutamate regulates vascular endothelial barrier function.
11801738 2002 DNA damage-dependent interaction of the nuclear matrix protein C1D with Translin-associated factor X (TRAX).
11525421 2001 Mutation screening of the metabotropic glutamate receptor mGluR4 (GRM4) gene in patients with schizophrenia.
10828590 2000 Assignment of the human metabotropic glutamate receptor gene GRM4 to chromosome 6 band p21.3 by radiation hybrid mapping.
10779504 2000 p300 and p300/cAMP-response element-binding protein-associated factor acetylate the androgen receptor at sites governing hormone-dependent transactivation.
9473604 1998 Group III human metabotropic glutamate receptors 4, 7 and 8: molecular cloning, functional expression, and comparison of pharmacological properties in RGT cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8863838 1996 Coupling of metabotropic glutamate receptors 2 and 4 to G alpha 15, G alpha 16, and chimeric G alpha q/i proteins: characterization of new antagonists.
8824806 1996 Localization of two metabotropic glutamate receptor genes, GRM3 and GRM8, to human chromosome 7q.
8738157 1996 Molecular characterization and localization of human metabotropic glutamate receptor type 4.
7617140 1995 Molecular cloning, functional expression and pharmacological characterization of the human metabotropic glutamate receptor type 4.