Property Summary

NCBI Gene PubMed Count 55
PubMed Score 31.24
PubTator Score 54.66

Knowledge Summary

Patent (6,483)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Arthritis, Rheumatoid 169 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3135 4.2e-05
psoriasis 6514 5.7e-05
osteosarcoma 7766 1.5e-02
non primary Sjogren syndrome sicca 861 2.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
WHIM syndrome 7 4.193 2.1

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 4.2e-05
non primary Sjogren syndrome sicca 1.100 2.4e-02
osteosarcoma -1.105 1.5e-02
psoriasis 1.700 5.7e-05

Protein-protein Interaction (4)

Gene RIF (25)

AA Sequence

MELENIVANTVLLKAREGGGGNRKGKSKKWRQMLQFPHISQCEELRLSLERDYHSLCERQPIGRLLFREF      1 - 70
CATRPELSRCVAFLDGVAEYEVTPDDKRKACGRQLTQNFLSHTGPDLIPEVPRQLVTNCTQRLEQGPCKD     71 - 140
LFQELTRLTHEYLSVAPFADYLDSIYFNRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGK    141 - 210
MYACKKLEKKRIKKRKGEAMALNEKQILEKVNSRFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGQ    211 - 280
AGFPEARAVFYAAEICCGLEDLHRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVG    281 - 350
YMAPEVVKNERYTFSPDWWALGCLLYEMIAGQSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQARSLC    351 - 420
SQLLCKDPAERLGCRGGSAREVKEHPLFKKLNFKRLGAGMLEPPFKPDPQAIYCKDVLDIEQFSTVKGVE    421 - 490
LEPTDQDFYQKFATGSVPIPWQNEMVETECFQELNVFGLDGSVPPDLDWKGQPPAPPKKGLLQRLFSRQD    491 - 560
CCGNCSDSEEELPTRL                                                          561 - 576
//

Text Mined References (60)

PMID Year Title