Property Summary

Ligand Count 1
NCBI Gene PubMed Count 88
PubMed Score 77.59
PubTator Score 96.50

Knowledge Summary

Patent (7,616)

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical adenoma -1.076 3.8e-02
adrenocortical carcinoma -1.464 2.4e-02
adult high grade glioma -1.400 8.2e-04
aldosterone-producing adenoma -1.451 3.8e-02
astrocytic glioma -1.500 1.8e-02
Barrett's esophagus 1.700 4.3e-02
breast carcinoma -1.200 1.9e-20
dermatomyositis 1.200 7.9e-03
ductal carcinoma in situ -1.300 1.7e-03
esophageal adenocarcinoma 1.300 4.0e-02
interstitial cystitis 1.400 1.9e-02
intraductal papillary-mucinous adenoma (... 1.400 8.4e-03
intraductal papillary-mucinous carcinoma... 1.400 8.5e-03
invasive ductal carcinoma -1.800 4.5e-03
lung adenocarcinoma -2.100 3.2e-18
lung cancer -1.700 3.4e-03
lung carcinoma -2.100 3.1e-18
malignant mesothelioma -2.000 4.7e-06
medulloblastoma, large-cell -2.600 1.7e-05
non-small cell lung cancer -1.627 5.4e-29
osteosarcoma 1.422 2.1e-04
ovarian cancer -2.800 1.4e-10
ulcerative colitis 2.400 2.7e-08
X-linked cerebral adrenoleukodystrophy -1.200 6.1e-03

 IMPC Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (62)

AA Sequence

MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEDLRRTIDRDYCSLCDKQPIGRLLFRQF      1 - 70
CETRPGLECYIQFLDSVAEYEVTPDEKLGEKGKEIMTKYLTPKSPVFIAQVGQDLVSQTEEKLLQKPCKE     71 - 140
LFSACAQSVHEYLRGEPFHEYLDSMFFDRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGK    141 - 210
MYACKRLEKKRIKKRKGESMALNEKQILEKVNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGN    211 - 280
PGFEEERALFYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGDLIRGRVGTVG    281 - 350
YMAPEVLNNQRYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKSIC    351 - 420
KMLLTKDAKQRLGCQEEGAAEVKRHPFFRNMNFKRLEAGMLDPPFVPDPRAVYCKDVLDIEQFSTVKGVN    421 - 490
LDHTDDDFYSKFSTGSVSIPWQNEMIETECFKELNVFGPNGTLPPDLNRNHPPEPPKKGLLQRLFKRQHQ    491 - 560
NNSKSSPSSKTSFNHHINSNHVSSNSTGSS                                            561 - 590
//

Text Mined References (93)

PMID Year Title