Property Summary

NCBI Gene PubMed Count 42
PubMed Score 36.43
PubTator Score 57.90

Knowledge Summary

Patent (4,304)

Expression

  Differential Expression (26)

Disease log2 FC p
interstitial lung disease 1.200 1.9e-02
malignant mesothelioma -1.200 8.6e-06
astrocytoma -1.200 3.8e-11
glioblastoma -3.200 1.0e-05
oligodendroglioma -1.300 3.6e-08
osteosarcoma -1.214 3.3e-03
ependymoma -2.500 3.7e-11
atypical teratoid / rhabdoid tumor -3.100 8.8e-07
medulloblastoma, large-cell -2.800 6.4e-06
adrenocortical carcinoma -1.246 1.1e-02
tuberculosis 1.300 1.4e-04
intraductal papillary-mucinous adenoma (... -2.500 6.1e-04
intraductal papillary-mucinous carcinoma... -3.100 8.6e-04
intraductal papillary-mucinous neoplasm ... -2.500 3.0e-02
lung cancer -1.900 6.2e-04
active Crohn's disease 1.433 6.3e-03
active ulcerative colitis 1.757 8.4e-03
cystic fibrosis -1.200 3.0e-05
adult high grade glioma -3.000 1.2e-06
pilocytic astrocytoma -2.300 6.0e-09
primary Sjogren syndrome 1.500 8.4e-05
breast carcinoma -1.300 7.1e-23
Breast cancer -1.600 6.5e-08
ductal carcinoma in situ -2.100 4.3e-04
invasive ductal carcinoma -2.700 6.7e-04
ovarian cancer -2.000 1.3e-05

 MGI Phenotype (1)

Protein-protein Interaction (7)

Gene RIF (26)

PMID Text
27049755 effects of GRK3 modulation appear to be specific to chemokine-mediated migration behaviors without influencing tumor cell proliferation or survival
24434559 data are consistent with the possibility that oncogenes can induce cellular stiffness via an HDAC6-induced reorganization of the vimentin intermediate filament network
23734232 Data indicate that CXCL12-induced phosphorylation at CXCR4 S346/347 was mediated by GRK2/3.
22086906 GRK3 is a negative regulator of cell growth whose expression is preferentially reduced in glioblastoma of the classical subtype as a consequence of activity in primary gliomagenic pathways.
21916780 In oral squamous cell carcinomas, malignant cells and surrounding tissue overexpress the ADRBK2 gene.
21784156 A reduced cortical concentration of GRK3 in schizophrenia (resembling that in aging) may result in altered G protein-dependent signaling, thus contributing to prefrontal deficits in schizophrenia.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20216086 mRNA levels for GRK3 were inversely correlated with systolic and diastolic blood pressure (day, night and 24 h), which suggests a protective role for GRK3 in the regulation of human blood pressure
19913121 Observational study of gene-disease association. (HuGE Navigator)
19766236 we found no evidence of altered levels of acetylated histone H3 at the affected allele compared to the common allele
19400979 The results of this study suggested that there were statistically significant decreases in protein and mRNA levels of G-protein subunits beta and gamma and of GRK3 in brain of bipolar disorder.
19086053 Observational study of gene-disease association. (HuGE Navigator)
18359007 The G-384A variant may alter binding of Sp1/Sp4 transcription factors resulting in an increase in gene transcription and an increase in vulnerability to bipolar disorder.
18274673 role for GRK3 in regulating CXCR4 attenuation and have provided a mechanistic link between the GRK3 pathway and the CXCR4-related WHIM(WT) disorder.
18075471 Observational study of gene-disease association. (HuGE Navigator)
18075471 Dysregulation in GRK3 expression alters signaling desensitization and thereby predisposes to the development of bipolar disease.
17621168 Observational study of gene-disease association. (HuGE Navigator)
17621168 No support for a major role for GRK3 gene promoter variants in cocaine addiction.
17106420 Observational study of gene-disease association. (HuGE Navigator)
15728711 ATP stimulation leads to GRK3 phosphorylation of P2X(7) receptor.
15498832 the CRH-R1alpha carboxyl tail is important for regulation of receptor activity by G protein-coupled receptor kinase
12808434 dysregulation in GRK3 expression alters signaling desensitization, and thereby predisposes to the development of bipolar disorder

AA Sequence

MADLEAVLADVSYLMAMEKSKATPAARASKRIVLPEPSIRSVMQKYLAERNEITFDKIFNQKIGFLLFKD      1 - 70
FCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSCSHPFSKQAVEHVQSHLSKKQ     71 - 140
VTSTLFQPYIEEICESLRGDIFQKFMESDKFTRFCQWKNVELNIHLTMNEFSVHRIIGRGGFGEVYGCRK    141 - 210
ADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLH    211 - 280
YHLSQHGVFSEKEMRFYATEIILGLEHMHNRFVVYRDLKPANILLDEHGHARISDLGLACDFSKKKPHAS    281 - 350
VGTHGYMAPEVLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPDTFSPE    351 - 420
LKSLLEGLLQRDVSKRLGCHGGGSQEVKEHSFFKGVDWQHVYLQKYPPPLIPPRGEVNAADAFDIGSFDE    421 - 490
EDTKGIKLLDCDQELYKNFPLVISERWQQEVTETVYEAVNADTDKIEARKRAKNKQLGHEEDYALGKDCI    491 - 560
MHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNLLTMEQILSVEETQIKDKKCILFRIKGGKQF    561 - 630
VLQCESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPRSGTVELPKPSLCHRNSNGL                631 - 688
//

Text Mined References (44)

PMID Year Title
27049755 2016 G Protein Coupled Receptor Kinase 3 Regulates Breast Cancer Migration, Invasion, and Metastasis.
24434559 2014 GRK3 is essential for metastatic cells and promotes prostate tumor progression.
23734232 2013 Hierarchical organization of multi-site phosphorylation at the CXCR4 C terminus.
22086906 2012 Suppression of G-protein-coupled receptor kinase 3 expression is a feature of classical GBM that is required for maximal growth.
21916780 2012 Activity of ?2-adrenergic receptor in oral squamous cell carcinoma is mediated by overexpression of the ADRBK2 gene: a pilot study.
21784156 2011 Reduced expression of G protein-coupled receptor kinases in schizophrenia but not in schizoaffective disorder.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20596523 2010 Development and validation of a method for profiling post-translational modification activities using protein microarrays.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20216086 2010 beta-Adrenoceptor and GRK3 expression in human lymphocytes is related to blood pressure and urinary albumin excretion.
20074556 2010 Function of the cytoplasmic tail of human calcitonin receptor-like receptor in complex with receptor activity-modifying protein 2.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19766236 2010 Allele specific analysis of the ADRBK2 gene in lymphoblastoid cells from bipolar disorder patients.
19400979 2009 Decreased GRK3 but not GRK2 expression in frontal cortex from bipolar disorder patients.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18359007 2008 Promoter variant in the GRK3 gene associated with bipolar disorder alters gene expression.
18274673 2008 Leukocyte analysis from WHIM syndrome patients reveals a pivotal role for GRK3 in CXCR4 signaling.
18075471 2007 Further evidence for association of GRK3 to bipolar disorder suggests a second disease mutation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17621168 2007 Association analysis of GRK3 gene promoter variants in cocaine abuse.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17106420 2006 Bipolar 1 disorder is not associated with the RGS4, PRODH, COMT and GRK3 genes.
15728711 2005 ATP stimulates GRK-3 phosphorylation and beta-arrestin-2-dependent internalization of P2X7 receptor.
15498832 2005 Regulation of corticotropin-releasing hormone receptor type 1alpha signaling: structural determinants for G protein-coupled receptor kinase-mediated phosphorylation and agonist-mediated desensitization.
15087239 2004 Differential functional expression of human myocardial G protein receptor kinases in left ventricular cardiac diseases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12808434 2003 Evidence that a single nucleotide polymorphism in the promoter of the G protein receptor kinase 3 gene is associated with bipolar disorder.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12130708 2002 Orphanin FQ/nociceptin-mediated desensitization of opioid receptor-like 1 receptor and mu opioid receptors involves protein kinase C: a molecular mechanism for heterologous cross-talk.
11762794 2001 G-protein coupled receptor kinase 2 and 3 expression in human detrusor cultured smooth muscle cells.
11668182 2001 Role of tyrosine phosphorylation in ligand-independent sequestration of CXCR4 in human primary monocytes-macrophages.
11517230 2001 Determination of bradykinin B2 receptor in vivo phosphorylation sites and their role in receptor function.
11060299 2001 Threonine 180 is required for G-protein-coupled receptor kinase 3- and beta-arrestin 2-mediated desensitization of the mu-opioid receptor in Xenopus oocytes.
10754297 2000 Human NK cells express CC chemokine receptors 4 and 8 and respond to thymus and activation-regulated chemokine, macrophage-derived chemokine, and I-309.
10591208 1999 The DNA sequence of human chromosome 22.
10085131 1999 Differential effects of CC chemokines on CC chemokine receptor 5 (CCR5) phosphorylation and identification of phosphorylation sites on the CCR5 carboxyl terminus.
9826657 1998 beta2-Adrenergic receptor regulation by GIT1, a G protein-coupled receptor kinase-associated ADP ribosylation factor GTPase-activating protein.
8662816 1996 Phosphorylation of the type 1A angiotensin II receptor by G protein-coupled receptor kinases and protein kinase C.
8427589 1993 Molecular cloning, functional expression and mRNA analysis of human beta-adrenergic receptor kinase 2.
7695743 1994 Chromosome mapping of the human arrestin (SAG), beta-arrestin 2 (ARRB2), and beta-adrenergic receptor kinase 2 (ADRBK2) genes.
1869533 1991 Cloning, expression, and chromosomal localization of beta-adrenergic receptor kinase 2. A new member of the receptor kinase family.