Property Summary

Ligand Count 42
NCBI Gene PubMed Count 190
PubMed Score 428.84
PubTator Score 385.46

Knowledge Summary

Patent (12,829)

Expression

  Differential Expression (7)

Disease log2 FC p
COPD -1.300 5.1e-04
diabetes mellitus -1.100 1.1e-03
medulloblastoma, large-cell 1.200 1.3e-05
osteosarcoma 2.176 1.5e-10
ovarian cancer 1.400 3.3e-13
psoriasis 2.500 1.9e-05
subependymal giant cell astrocytoma -1.209 5.0e-02

Protein-protein Interaction (3)

PDB (12)

Gene RIF (135)

AA Sequence

MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFSQKLGYLLFRD      1 - 70
FCLNHLEEARPLVEFYEEIKKYEKLETEEERVARSREIFDSYIMKELLACSHPFSKSATEHVQGHLGKKQ     71 - 140
VPPDLFQPYIEEICQNLRGDVFQKFIESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRK    141 - 210
ADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLH    211 - 280
YHLSQHGVFSEADMRFYAAEIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHAS    281 - 350
VGTHGYMAPEVLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE    351 - 420
LRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDE    421 - 490
EDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARKKAKNKQLGHEEDYALGKDCI    491 - 560
MHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQF    561 - 630
ILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL               631 - 689
//

Text Mined References (194)

PMID Year Title