Property Summary

NCBI Gene PubMed Count 11
PubMed Score 8.30
PubTator Score 6.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3578 1.9e-11
glioblastoma 5792 3.2e-05
active ulcerative colitis 764 5.6e-03
Disease Target Count Z-score Confidence
Fabry disease 11 3.304 1.7
Stiff-Person syndrome 12 3.023 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
active ulcerative colitis 1.230 5.6e-03
Breast cancer 1.100 1.9e-11
glioblastoma 1.100 3.2e-05

Gene RIF (34)

AA Sequence

MSHEKSFLVSGDNYPPPNPGYPGGPQPPMPPYAQPPYPGAPYPQPPFQPSPYGQPGYPHGPSPYPQGGYP      1 - 70
QGPYPQGGYPQGPYPQEGYPQGPYPQGGYPQGPYPQSPFPPNPYGQPQVFPGQDPDSPQHGNYQEEGPPS     71 - 140
YYDNQDFPATNWDDKSIRQAFIRKVFLVLTLQLSVTLSTVSVFTFVAEVKGFVRENVWTYYVSYAVFFIS    141 - 210
LIVLSCCGDFRRKHPWNLVALSVLTASLSYMVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFT    211 - 280
SCMGVLLVSMVVLFIFAILCIFIRNRILEIVYASLGALLFTCFLAVDTQLLLGNKQLSLSPEEYVFAALN    281 - 350
LYTDIINIFLYILTIIGRAKE                                                     351 - 371
//

Text Mined References (14)

PMID Year Title