| Tclin | Glutamate receptor ionotropic, NMDA 3A |
NMDA receptor subtype of glutamate-gated ion channels with reduced single-channel conductance, low calcium permeability and low voltage-dependent sensitivity to magnesium. Mediated by glycine. May play a role in the development of dendritic spines. May play a role in PPP2CB-NMDAR mediated signaling mechanism (By similarity).
This gene encodes a subunit of the N-methyl-D-aspartate (NMDA) receptors, which belong to the superfamily of glutamate-regulated ion channels, and function in physiological and pathological processes in the central nervous system. This subunit shows greater than 90% identity to the corresponding subunit in rat. Studies in the knockout mouse deficient in this subunit suggest that this gene may be involved in the development of synaptic elements by modulating NMDA receptor activity. [provided by RefSeq, Jul 2008]
This gene encodes a subunit of the N-methyl-D-aspartate (NMDA) receptors, which belong to the superfamily of glutamate-regulated ion channels, and function in physiological and pathological processes in the central nervous system. This subunit shows greater than 90% identity to the corresponding subunit in rat. Studies in the knockout mouse deficient in this subunit suggest that this gene may be involved in the development of synaptic elements by modulating NMDA receptor activity. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count |
|---|---|
| Erectile dysfunction | 10 |
| Disease | Target Count | P-value |
|---|---|---|
| psoriasis | 6685 | 5.3e-51 |
| ependymoma | 2514 | 3.0e-11 |
| atypical teratoid / rhabdoid tumor | 4369 | 1.3e-06 |
| pilocytic astrocytoma | 3086 | 1.5e-05 |
| pediatric high grade glioma | 2712 | 3.7e-05 |
| glioblastoma | 5572 | 8.4e-05 |
| astrocytic glioma | 2241 | 2.0e-03 |
| primitive neuroectodermal tumor | 3031 | 4.5e-03 |
| medulloblastoma | 1524 | 5.0e-03 |
| medulloblastoma, large-cell | 6234 | 5.0e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Cardiovascular system disease | 194 | 0.0 | 2.0 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Schizophrenia | 503 | 3.621 | 1.8 |
| Disease | log2 FC | p |
|---|---|---|
| astrocytic glioma | -1.700 | 2.0e-03 |
| ependymoma | -2.600 | 3.0e-11 |
| glioblastoma | -3.100 | 8.4e-05 |
| atypical teratoid / rhabdoid tumor | -3.100 | 1.3e-06 |
| medulloblastoma | -2.300 | 5.0e-03 |
| medulloblastoma, large-cell | -2.100 | 5.0e-02 |
| primitive neuroectodermal tumor | -2.600 | 4.5e-03 |
| pediatric high grade glioma | -2.500 | 3.7e-05 |
| pilocytic astrocytoma | -2.600 | 1.5e-05 |
| psoriasis | -1.500 | 5.3e-51 |
| PMID | Text | |
|---|---|---|
| 26265699 | Single nucleotide polymorphism in GRIN3A is associated with osteonecrosis in children with acute lymphoblastic leukemia. | |
| 25450229 | The rare variants in GRIN3A were significantly associated with smoking status. | |
| 25041634 | the genetic variations of NR3A subunit of NMDA receptor may be a predisposing factor to delirium among the Polish population of cardiac surgery patients | |
| 25017909 | Isolated GluN1/GluN3A receptors integrated into lipid bilayers responded to addition of either glycine or d-serine, but not glutamate, with a approximately 1 nm reduction in height of the extracellular domain | |
| 24739951 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 24386575 | This review highlights GluN3A properties and addresses its role in neurophysiology and associated pathologies--{REVIEW} | |
| 24332987 | It modulates episodic memory. | |
| 24278430 | Our results suggest that a polymorphism of the GRIN3A gene may play a role in KD pathogenesis. | |
| 24086760 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 23852340 | These findings reveal an early pathogenic role of GluN3A dysregulation in Huntington's disease. | |
| 23237318 | the GRIN3A R480G variant showed the strongest association with schizophrenia. | |
| 22940423 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 22914463 | Vasoactive intestinal polypeptipe and GRIN3A SNPs may be associated with cerebral palsy at age 2 in children born preterm. | |
| 22801082 | reductions of toxic calpain activation might be linked to inhibition by GluN3A of pathological extrasynaptic NMDAR activity. | |
| 22552781 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 22114277 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 21948112 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 21491143 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 21429969 | NR3a, by maintaining low intracellular calcium levels, protects the function of the principal cells to reabsorb water and thereby increase medullary osmolality | |
| 21152063 | Data show that that all seven currently known NMDAR subunits (NR1, NR2A, NR2B, NR2C, NR2D, NR3A and NR3B) are expressed in astrocytes, but at different levels. | |
| 21135540 | In a human embryonic brain cDNA library mTOR-activating GTPase Rheb is screened as an interacting protein of the NMDAR subunit NR3A. | |
| 20628086 | Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) | |
| 20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) | |
| 20084518 | Results indicate that GRIN3A is significantly associated with nicotine dependence. | |
| 20084518 | Observational study of gene-disease association. (HuGE Navigator) | |
| 20016182 | These observations suggest that the genetic variation of the NR3A subunit of the NMDA receptor may be a risk factor for Alzheimer's dis pathogenesis | |
| 20016182 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19913121 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19665356 | This study indicated that rare mutations in the GRIN3A gene may contribute to the pathogenesis of schizophrenia in certain patients. | |
| 19665356 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19526283 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 19488045 | significant lower protein and mRNA levels of the N-methyl-D-aspartate receptors, NR-1 and hr-3a in frontal corte in bipolar disorder. | |
| 19386922 | NMDA receptor protein subunit NR3A overexpressed in transgenic mice protects them from neuronal damage due to cerebral ischemia. | |
| 19295509 | Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) | |
| 19156168 | Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) | |
| 19086053 | Observational study of gene-disease association. (HuGE Navigator) | |
| 18649358 | Observational study of gene-disease association. (HuGE Navigator) | |
| 18296432 | NR3A levels are low during gestation, surge soon after birth, and decline progressively through adolescence and into adulthood | |
| 18075478 | a case-control association study of common nucleotide variants of the GRIN3A gene with susceptibility to schizophrenia; findings did not show any difference in allele and genotype frequency of each polymorphism between patients and controls | |
| 17997397 | NR3A was found in the cerebral cortex, subcortical forebrain, midbrain and hindbrain. Very low levels of NR3A could be detected in homogenized adult human spinal cord, limited to ventral motoneurons. | |
| 17617428 | This review summarizes recent research regarding the functional roles of the N-methyl-D-aspartate (NMDA) receptor subunit NR3A in dendrite spine formation, plasticity and synaptogenesis, and sensory processing in the spinal cord [review]. | |
| 17214563 | Observational study of gene-disease association. (HuGE Navigator) | |
| 17214563 | Individuals carrying Val/Val genotype showed significantly reduced frontal P300 amplitudes compared with Met/Met subjects. | |
| 17047094 | NR3 NMDA receptors induce plasticity in NR1 with respect to subunit assembly and ligand binding/channel coupling that is unique among ligand-gated ion channel subunits. | |
| 16489129 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 16481105 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 15749123 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 14684485 | NR3A is highly expressed in the developing human neocortex | |
| 14644469 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 12775422 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 12414113 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 11606043 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 11483648 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 10555109 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 10448428 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 10197777 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 9745929 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 9651389 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 8955056 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 8845955 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 8822372 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 8821747 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 8804048 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 8724036 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 8581564 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 8563977 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis | |
| 7695237 | HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis |
MRRLSLWWLLSRVCLLLPPPCALVLAGVPSSSSHPQPCQILKRIGHAVRVGAVHLQPWTTAPRAASRAPD 1 - 70 DSRAGAQRDEPEPGTRRSPAPSPGARWLGSTLHGRGPPGSRKPGEGARAEALWPRDALLFAVDNLNRVEG 71 - 140 LLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSDPFSFLQSVCHTVVVQGVSALLAFPQSQGEMMELD 141 - 210 LVSLVLHIPVISIVRHEFPRESQNPLHLQLSLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFL 211 - 280 LLTQNNSKFHLGSIINITANLPSTQDLLSFLQIQLESIKNSTPTVVMFGCDMESIRRIFEITTQFGVMPP 281 - 350 ELRWVLGDSQNVEELRTEGLPLGLIAHGKTTQSVFEHYVQDAMELVARAVATATMIQPELALIPSTMNCM 351 - 420 EVETTNLTSGQYLSRFLANTTFRGLSGSIRVKGSTIVSSENNFFIWNLQHDPMGKPMWTRLGSWQGGKIV 421 - 490 MDYGIWPEQAQRHKTHFQHPSKLHLRVVTLIEHPFVFTREVDDEGLCPAGQLCLDPMTNDSSTLDSLFSS 491 - 560 LHSSNDTVPIKFKKCCYGYCIDLLEKIAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLRGTAHMAVT 561 - 630 SFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAVFLTLYEWKSP 631 - 700 FGLTPKGRNRSKVFSFSSALNICYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVG 701 - 770 EKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVEYLKNDPEKLD 771 - 840 AFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTANISELISQYKSHGFMDMLHDKWYRV 841 - 910 VPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYWLHTSQRLH 911 - 980 RAINTSFIEEKQQHFKTKRVEKRSNVGPRQLTVWNTSNLSHDNRRKYIFSDEEGQNQLGIRIHQDIPLPP 981 - 1050 RRRELPALRTTNGKADSLNVSRNSVMQELSELEKQIQVIRQELQLAVSRKTELEEYQRTSRTCES 1051 - 1115 //
| PMID | Year | Title | |
|---|---|---|---|
| 26265699 | 2015 | Genetics of glucocorticoid-associated osteonecrosis in children with acute lymphoblastic leukemia. | |
| 25450229 | 2015 | The contribution of rare and common variants in 30 genes to risk nicotine dependence. | |
| 25041634 | The assessment of the T102C polymorphism of the 5HT2a receptor gene, 3723G/A polymorphism of the NMDA receptor 3A subunit gene (GRIN3A) and 421C/A polymorphism of the NMDA receptor 2B subunit gene (GRIN2B) among cardiac surgery patients with and without delirium. | ||
| 25017909 | 2014 | Activation-induced structural change in the GluN1/GluN3A excitatory glycine receptor. | |
| 24386575 | 2013 | GluN3A: an NMDA receptor subunit with exquisite properties and functions. | |
| 24332987 | 2014 | Dopamine and glutamate receptor genes interactively influence episodic memory in old age. | |
| 24278430 | 2013 | Association between GRIN3A gene polymorphism in Kawasaki disease and coronary artery aneurysms in Taiwanese children. | |
| 23870195 | 2013 | Genetics of coronary artery calcification among African Americans, a meta-analysis. | |
| 23852340 | 2013 | Suppressing aberrant GluN3A expression rescues synaptic and behavioral impairments in Huntington's disease models. | |
| 23400010 | 2014 | Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans. | |
| 23251661 | 2012 | Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population. | |
| 23237318 | 2013 | A population-specific uncommon variant in GRIN3A associated with schizophrenia. | |
| 22914463 | 2012 | Association of polymorphisms in neuroprotection and oxidative stress genes and neurodevelopmental outcomes after preterm birth. | |
| 22801082 | 2012 | The NMDA receptor subunit GluN3A protects against 3-nitroproprionic-induced striatal lesions via inhibition of calpain activation. | |
| 21429969 | 2011 | N-methyl-D-aspartate receptor subunit NR3a expression and function in principal cells of the collecting duct. | |
| 21152063 | 2010 | Characterisation of the expression of NMDA receptors in human astrocytes. | |
| 21135540 | 2010 | Association of the small GTPase Rheb with the NMDA receptor subunit NR3A. | |
| 20628086 | 2010 | Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. | |
| 20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | ||
| 20084518 | 2010 | Significant association of glutamate receptor, ionotropic N-methyl-D-aspartate 3A (GRIN3A), with nicotine dependence in European- and African-American smokers. | |
| 20016182 | 2009 | Genetic variation in N-methyl-D-aspartate receptor subunit NR3A but not NR3B influences susceptibility to Alzheimer's disease. | |
| 19913121 | 2009 | Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip. | |
| 19665356 | 2009 | Exomic sequencing of the ionotropic glutamate receptor N-methyl-D-aspartate 3A gene (GRIN3A) reveals no association with schizophrenia. | |
| 19488045 | 2010 | Increased excitotoxicity and neuroinflammatory markers in postmortem frontal cortex from bipolar disorder patients. | |
| 19386922 | 2009 | Neuroprotection by the NR3A subunit of the NMDA receptor. | |
| 19295509 | 2009 | Genetic and clinical predictors of sexual dysfunction in citalopram-treated depressed patients. | |
| 19156168 | 2009 | Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis. | |
| 19086053 | 2009 | Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment. | |
| 18649358 | 2008 | Replication of a genome-wide case-control study of esophageal squamous cell carcinoma. | |
| 18445116 | 2008 | Enhanced ethanol inhibition of recombinant N-methyl-D-aspartate receptors by magnesium: role of NR3A subunits. | |
| 18296432 | 2008 | Developmental regulation of the NMDA receptor subunits, NR3A and NR1, in human prefrontal cortex. | |
| 18075478 | 2007 | A putative regulatory subunit (NR3A) of the NMDA receptor complex as candidate gene for susceptibility to schizophrenia: a case-control study. | |
| 17997397 | 2007 | Analysis of NR3A receptor subunits in human native NMDA receptors. | |
| 17658481 | 2007 | The NMDAR subunit NR3A interacts with microtubule-associated protein 1S in the brain. | |
| 17617428 | 2007 | On the role of NR3A in human NMDA receptors. | |
| 17502428 | 2007 | Pharmacological characterization of glycine-activated currents in HEK 293 cells expressing N-methyl-D-aspartate NR1 and NR3 subunits. | |
| 17320117 | 2007 | Characterisation of the human NMDA receptor subunit NR3A glycine binding site. | |
| 17214563 | 2007 | Genetic variations of the NR3A subunit of the NMDA receptor modulate prefrontal cerebral activity in humans. | |
| 17047094 | 2007 | Subunit-specific roles of glycine-binding domains in activation of NR1/NR3 N-methyl-D-aspartate receptors. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15164053 | 2004 | DNA sequence and analysis of human chromosome 9. | |
| 14760703 | 2004 | Proteomic identification of brain proteins that interact with dynein light chain LC8. | |
| 14684485 | 2003 | Expression of the NR3A subunit of the NMDA receptor in human fetal brain. | |
| 14644469 | 2004 | The human immunodeficiency virus type-1 transcription factor Tat produces elevations in intracellular Ca2+ that require function of an N-methyl-D-aspartate receptor polyamine-sensitive site. | |
| 12775422 | 2003 | Human immunodeficiency virus type 1 Tat protein directly activates neuronal N-methyl-D-aspartate receptors at an allosteric zinc-sensitive site. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12414113 | 2002 | Neurotoxic effects of the human immunodeficiency virus type-1 transcription factor Tat require function of a polyamine sensitive-site on the N-methyl-D-aspartate receptor. | |
| 12391275 | 2002 | Association of NR3A with the N-methyl-D-aspartate receptor NR1 and NR2 subunits. | |
| 11880201 | 2002 | Cloning and expression of the human N-methyl-D-aspartate receptor subunit NR3A. | |
| 11853319 | 2001 | Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins. | |
| 11735224 | 2001 | Nucleotide sequence, genomic organization, and chromosomal localization of genes encoding the human NMDA receptor subunits NR3A and NR3B. | |
| 11606043 | 2001 | HIV-1 Tat causes apoptotic death and calcium homeostasis alterations in rat neurons. | |
| 11588171 | 2001 | An NMDA receptor signaling complex with protein phosphatase 2A. | |
| 11483648 | 2001 | HIV-1 Tat through phosphorylation of NMDA receptors potentiates glutamate excitotoxicity. | |
| 11160393 | 2001 | Assembly with the NR1 subunit is required for surface expression of NR3A-containing NMDA receptors. | |
| 10197777 | 1999 | Tat, a human immunodeficiency virus-1-derived protein, augments excitotoxic hippocampal injury in neonatal rats. | |
| 9651389 | 1998 | HIV-1 Tat induces neuronal death via tumor necrosis factor-alpha and activation of non-N-methyl-D-aspartate receptors by a NFkappaB-independent mechanism. | |
| 9620802 | 1998 | Increased NMDA current and spine density in mice lacking the NMDA receptor subunit NR3A. | |
| 7695237 | 1995 | Human immunodeficiency virus type 1 tat activates non-N-methyl-D-aspartate excitatory amino acid receptors and causes neurotoxicity. | |
| 7569905 | 1995 | Domain interaction between NMDA receptor subunits and the postsynaptic density protein PSD-95. |
