Property Summary

NCBI Gene PubMed Count 58
PubMed Score 79.90
PubTator Score 50.09

Knowledge Summary

Patent (3,964)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.700 2.0e-03
ependymoma -2.600 3.0e-11
glioblastoma -3.100 8.4e-05
atypical teratoid / rhabdoid tumor -3.100 1.3e-06
medulloblastoma -2.300 5.0e-03
medulloblastoma, large-cell -2.100 5.0e-02
primitive neuroectodermal tumor -2.600 4.5e-03
pediatric high grade glioma -2.500 3.7e-05
pilocytic astrocytoma -2.600 1.5e-05
psoriasis -1.500 5.3e-51

Gene RIF (67)

PMID Text
26265699 Single nucleotide polymorphism in GRIN3A is associated with osteonecrosis in children with acute lymphoblastic leukemia.
25450229 The rare variants in GRIN3A were significantly associated with smoking status.
25041634 the genetic variations of NR3A subunit of NMDA receptor may be a predisposing factor to delirium among the Polish population of cardiac surgery patients
25017909 Isolated GluN1/GluN3A receptors integrated into lipid bilayers responded to addition of either glycine or d-serine, but not glutamate, with a approximately 1 nm reduction in height of the extracellular domain
24739951 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
24386575 This review highlights GluN3A properties and addresses its role in neurophysiology and associated pathologies--{REVIEW}
24332987 It modulates episodic memory.
24278430 Our results suggest that a polymorphism of the GRIN3A gene may play a role in KD pathogenesis.
24086760 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
23852340 These findings reveal an early pathogenic role of GluN3A dysregulation in Huntington's disease.
23237318 the GRIN3A R480G variant showed the strongest association with schizophrenia.
22940423 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
22914463 Vasoactive intestinal polypeptipe and GRIN3A SNPs may be associated with cerebral palsy at age 2 in children born preterm.
22801082 reductions of toxic calpain activation might be linked to inhibition by GluN3A of pathological extrasynaptic NMDAR activity.
22552781 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
22114277 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
21948112 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
21491143 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
21429969 NR3a, by maintaining low intracellular calcium levels, protects the function of the principal cells to reabsorb water and thereby increase medullary osmolality
21152063 Data show that that all seven currently known NMDAR subunits (NR1, NR2A, NR2B, NR2C, NR2D, NR3A and NR3B) are expressed in astrocytes, but at different levels.
21135540 In a human embryonic brain cDNA library mTOR-activating GTPase Rheb is screened as an interacting protein of the NMDAR subunit NR3A.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20084518 Results indicate that GRIN3A is significantly associated with nicotine dependence.
20084518 Observational study of gene-disease association. (HuGE Navigator)
20016182 These observations suggest that the genetic variation of the NR3A subunit of the NMDA receptor may be a risk factor for Alzheimer's dis pathogenesis
20016182 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19665356 This study indicated that rare mutations in the GRIN3A gene may contribute to the pathogenesis of schizophrenia in certain patients.
19665356 Observational study of gene-disease association. (HuGE Navigator)
19526283 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
19488045 significant lower protein and mRNA levels of the N-methyl-D-aspartate receptors, NR-1 and hr-3a in frontal corte in bipolar disorder.
19386922 NMDA receptor protein subunit NR3A overexpressed in transgenic mice protects them from neuronal damage due to cerebral ischemia.
19295509 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18649358 Observational study of gene-disease association. (HuGE Navigator)
18296432 NR3A levels are low during gestation, surge soon after birth, and decline progressively through adolescence and into adulthood
18075478 a case-control association study of common nucleotide variants of the GRIN3A gene with susceptibility to schizophrenia; findings did not show any difference in allele and genotype frequency of each polymorphism between patients and controls
17997397 NR3A was found in the cerebral cortex, subcortical forebrain, midbrain and hindbrain. Very low levels of NR3A could be detected in homogenized adult human spinal cord, limited to ventral motoneurons.
17617428 This review summarizes recent research regarding the functional roles of the N-methyl-D-aspartate (NMDA) receptor subunit NR3A in dendrite spine formation, plasticity and synaptogenesis, and sensory processing in the spinal cord [review].
17214563 Observational study of gene-disease association. (HuGE Navigator)
17214563 Individuals carrying Val/Val genotype showed significantly reduced frontal P300 amplitudes compared with Met/Met subjects.
17047094 NR3 NMDA receptors induce plasticity in NR1 with respect to subunit assembly and ligand binding/channel coupling that is unique among ligand-gated ion channel subunits.
16489129 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
16481105 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
15749123 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
14684485 NR3A is highly expressed in the developing human neocortex
14644469 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
12775422 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
12414113 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
11606043 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
11483648 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
10555109 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
10448428 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
10197777 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
9745929 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
9651389 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
8955056 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
8845955 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
8822372 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
8821747 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
8804048 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
8724036 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
8581564 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
8563977 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis
7695237 HIV-1 Tat upregulates the expression of NMDARs for the apoptosis of retinal pigmen epithelium (RPE) cells. Silencing of NMDARs by siRNA abolishes Tat-induced RPE apoptosis

AA Sequence

MRRLSLWWLLSRVCLLLPPPCALVLAGVPSSSSHPQPCQILKRIGHAVRVGAVHLQPWTTAPRAASRAPD      1 - 70
DSRAGAQRDEPEPGTRRSPAPSPGARWLGSTLHGRGPPGSRKPGEGARAEALWPRDALLFAVDNLNRVEG     71 - 140
LLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSDPFSFLQSVCHTVVVQGVSALLAFPQSQGEMMELD    141 - 210
LVSLVLHIPVISIVRHEFPRESQNPLHLQLSLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFL    211 - 280
LLTQNNSKFHLGSIINITANLPSTQDLLSFLQIQLESIKNSTPTVVMFGCDMESIRRIFEITTQFGVMPP    281 - 350
ELRWVLGDSQNVEELRTEGLPLGLIAHGKTTQSVFEHYVQDAMELVARAVATATMIQPELALIPSTMNCM    351 - 420
EVETTNLTSGQYLSRFLANTTFRGLSGSIRVKGSTIVSSENNFFIWNLQHDPMGKPMWTRLGSWQGGKIV    421 - 490
MDYGIWPEQAQRHKTHFQHPSKLHLRVVTLIEHPFVFTREVDDEGLCPAGQLCLDPMTNDSSTLDSLFSS    491 - 560
LHSSNDTVPIKFKKCCYGYCIDLLEKIAEDMNFDFDLYIVGDGKYGAWKNGHWTGLVGDLLRGTAHMAVT    561 - 630
SFSINTARSQVIDFTSPFFSTSLGILVRTRDTAAPIGAFMWPLHWTMWLGIFVALHITAVFLTLYEWKSP    631 - 700
FGLTPKGRNRSKVFSFSSALNICYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVG    701 - 770
EKIYEELSGIHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVEYLKNDPEKLD    771 - 840
AFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTANISELISQYKSHGFMDMLHDKWYRV    841 - 910
VPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLLPRIKNKSKLQYWLHTSQRLH    911 - 980
RAINTSFIEEKQQHFKTKRVEKRSNVGPRQLTVWNTSNLSHDNRRKYIFSDEEGQNQLGIRIHQDIPLPP    981 - 1050
RRRELPALRTTNGKADSLNVSRNSVMQELSELEKQIQVIRQELQLAVSRKTELEEYQRTSRTCES        1051 - 1115
//

Text Mined References (60)

PMID Year Title
26265699 2015 Genetics of glucocorticoid-associated osteonecrosis in children with acute lymphoblastic leukemia.
25450229 2015 The contribution of rare and common variants in 30 genes to risk nicotine dependence.
25041634 The assessment of the T102C polymorphism of the 5HT2a receptor gene, 3723G/A polymorphism of the NMDA receptor 3A subunit gene (GRIN3A) and 421C/A polymorphism of the NMDA receptor 2B subunit gene (GRIN2B) among cardiac surgery patients with and without delirium.
25017909 2014 Activation-induced structural change in the GluN1/GluN3A excitatory glycine receptor.
24386575 2013 GluN3A: an NMDA receptor subunit with exquisite properties and functions.
24332987 2014 Dopamine and glutamate receptor genes interactively influence episodic memory in old age.
24278430 2013 Association between GRIN3A gene polymorphism in Kawasaki disease and coronary artery aneurysms in Taiwanese children.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23852340 2013 Suppressing aberrant GluN3A expression rescues synaptic and behavioral impairments in Huntington's disease models.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23237318 2013 A population-specific uncommon variant in GRIN3A associated with schizophrenia.
22914463 2012 Association of polymorphisms in neuroprotection and oxidative stress genes and neurodevelopmental outcomes after preterm birth.
22801082 2012 The NMDA receptor subunit GluN3A protects against 3-nitroproprionic-induced striatal lesions via inhibition of calpain activation.
21429969 2011 N-methyl-D-aspartate receptor subunit NR3a expression and function in principal cells of the collecting duct.
21152063 2010 Characterisation of the expression of NMDA receptors in human astrocytes.
21135540 2010 Association of the small GTPase Rheb with the NMDA receptor subunit NR3A.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20084518 2010 Significant association of glutamate receptor, ionotropic N-methyl-D-aspartate 3A (GRIN3A), with nicotine dependence in European- and African-American smokers.
20016182 2009 Genetic variation in N-methyl-D-aspartate receptor subunit NR3A but not NR3B influences susceptibility to Alzheimer's disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19665356 2009 Exomic sequencing of the ionotropic glutamate receptor N-methyl-D-aspartate 3A gene (GRIN3A) reveals no association with schizophrenia.
19488045 2010 Increased excitotoxicity and neuroinflammatory markers in postmortem frontal cortex from bipolar disorder patients.
19386922 2009 Neuroprotection by the NR3A subunit of the NMDA receptor.
19295509 2009 Genetic and clinical predictors of sexual dysfunction in citalopram-treated depressed patients.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18649358 2008 Replication of a genome-wide case-control study of esophageal squamous cell carcinoma.
18445116 2008 Enhanced ethanol inhibition of recombinant N-methyl-D-aspartate receptors by magnesium: role of NR3A subunits.
18296432 2008 Developmental regulation of the NMDA receptor subunits, NR3A and NR1, in human prefrontal cortex.
18075478 2007 A putative regulatory subunit (NR3A) of the NMDA receptor complex as candidate gene for susceptibility to schizophrenia: a case-control study.
17997397 2007 Analysis of NR3A receptor subunits in human native NMDA receptors.
17658481 2007 The NMDAR subunit NR3A interacts with microtubule-associated protein 1S in the brain.
17617428 2007 On the role of NR3A in human NMDA receptors.
17502428 2007 Pharmacological characterization of glycine-activated currents in HEK 293 cells expressing N-methyl-D-aspartate NR1 and NR3 subunits.
17320117 2007 Characterisation of the human NMDA receptor subunit NR3A glycine binding site.
17214563 2007 Genetic variations of the NR3A subunit of the NMDA receptor modulate prefrontal cerebral activity in humans.
17047094 2007 Subunit-specific roles of glycine-binding domains in activation of NR1/NR3 N-methyl-D-aspartate receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
14684485 2003 Expression of the NR3A subunit of the NMDA receptor in human fetal brain.
14644469 2004 The human immunodeficiency virus type-1 transcription factor Tat produces elevations in intracellular Ca2+ that require function of an N-methyl-D-aspartate receptor polyamine-sensitive site.
12775422 2003 Human immunodeficiency virus type 1 Tat protein directly activates neuronal N-methyl-D-aspartate receptors at an allosteric zinc-sensitive site.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414113 2002 Neurotoxic effects of the human immunodeficiency virus type-1 transcription factor Tat require function of a polyamine sensitive-site on the N-methyl-D-aspartate receptor.
12391275 2002 Association of NR3A with the N-methyl-D-aspartate receptor NR1 and NR2 subunits.
11880201 2002 Cloning and expression of the human N-methyl-D-aspartate receptor subunit NR3A.
11853319 2001 Prediction of the coding sequences of unidentified human genes. XXII. The complete sequences of 50 new cDNA clones which code for large proteins.
11735224 2001 Nucleotide sequence, genomic organization, and chromosomal localization of genes encoding the human NMDA receptor subunits NR3A and NR3B.
11606043 2001 HIV-1 Tat causes apoptotic death and calcium homeostasis alterations in rat neurons.
11588171 2001 An NMDA receptor signaling complex with protein phosphatase 2A.
11483648 2001 HIV-1 Tat through phosphorylation of NMDA receptors potentiates glutamate excitotoxicity.
11160393 2001 Assembly with the NR1 subunit is required for surface expression of NR3A-containing NMDA receptors.
10197777 1999 Tat, a human immunodeficiency virus-1-derived protein, augments excitotoxic hippocampal injury in neonatal rats.
9651389 1998 HIV-1 Tat induces neuronal death via tumor necrosis factor-alpha and activation of non-N-methyl-D-aspartate receptors by a NFkappaB-independent mechanism.
9620802 1998 Increased NMDA current and spine density in mice lacking the NMDA receptor subunit NR3A.
7695237 1995 Human immunodeficiency virus type 1 tat activates non-N-methyl-D-aspartate excitatory amino acid receptors and causes neurotoxicity.
7569905 1995 Domain interaction between NMDA receptor subunits and the postsynaptic density protein PSD-95.