Property Summary

NCBI Gene PubMed Count 38
PubMed Score 122.78
PubTator Score 48.19

Knowledge Summary

Patent (5,248)

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.600 3.3e-02
posterior fossa group B ependymoma -1.200 4.4e-06
ovarian cancer 1.100 1.1e-07

Gene RIF (48)

PMID Text
25760043 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25613138 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
24739951 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
24086760 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
23665428 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
23267846 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
22940423 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
22833210 Absence of truncating mutation in GRIN1 and GRIN2D genes in patients with autism spectrum disorder and schizophrenia and controls.
22552781 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
22486492 After 7 days of chronic alcohol exposure, there are significant increases in mRNA expression of GRIN2D in cultured neurons derived from alcoholic subjects, but not in cultures from nonalcoholics.
22114277 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
21948112 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
21915661 In microsatellite instable and microsatellite and chromosomally stable cancers, CIMP and BRAF/KRAS mutations are similarly distributed indicating common mechanisms of tumor initiation or progression in the molecular pathogenesis.
21670103 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
21491143 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
19526283 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19125103 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19036954 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
19020013 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
18444252 Observational study of gene-disease association. (HuGE Navigator)
17360663 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
16697675 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
16489129 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
16481105 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
16328341 data show that the NMDAR2D was specifically expressed in cultivated keratinocytes
16094258 Observational study of gene-disease association. (HuGE Navigator)
15749123 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
14644469 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
12775422 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
12414113 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
12082569 Observational study of gene-disease association. (HuGE Navigator)
11606043 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
11483648 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
10555109 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
10448428 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
10197777 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
9745929 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
9651389 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
8955056 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
8845955 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
8822372 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
8821747 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
8804048 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
8724036 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
8581564 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
8563977 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
7695237 The gene expression of GRIN2D is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells

AA Sequence

MRGAGGPRGPRGPAKMLLLLALACASPFPEEAPGPGGAGGPGGGLGGARPLNVALVFSGPAYAAEAARLG      1 - 70
PAVAAAVRSPGLDVRPVALVLNGSDPRSLVLQLCDLLSGLRVHGVVFEDDSRAPAVAPILDFLSAQTSLP     71 - 140
IVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLEEYDWTSFVAVTTRAPGHRAFLSYIEVLTDG    141 - 210
SLVGWEHRGALTLDPGAGEAVLSAQLRSVSAQIRLLFCAREEAEPVFRAAEEAGLTGSGYVWFMVGPQLA    211 - 280
GGGGSGAPGEPPLLPGGAPLPAGLFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRA    281 - 350
QNRTHRGESLHRYFMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYG    351 - 420
RFLQPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPEKRCCKGFCID    421 - 490
ILKRLAHTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSLTINEERSEIVDFSVPFVETG    491 - 560
ISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVFIFEYLSPVGYNRSLATGKRPGGSTFTIG    561 - 630
KSIWLLWALVFNNSVPVENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQR    631 - 700
PQEQYPPLKFGTVPNGSTEKNIRSNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKD    701 - 770
EGCKLVTIGSGKVFATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWLSGICHNDKIEVMSSKL    771 - 840
DIDNMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHCLGPTHRMDFLLAFSRGMYSCCSAEAAPPPAKPPP    841 - 910
PPQPLPSPAYPAPRPAPGPAPFVPRERASVDRWRRTKGAGPPGGAGLADGFHRYYGPIEPQGLGLGLGEA    911 - 980
RAAPRGAAGRPLSPPAAQPPQKPPPSYFAIVRDKEPAEPPAGAFPGFPSPPAPPAAAATAVGPPLCRLAF    981 - 1050
EDESPPAPARWPRSDPESQPLLGPGAGGAGGTGGAGGGAPAAPPPCRAAPPPCPYLDLEPSPSDSEDSES   1051 - 1120
LGGASLGGLEPWWFADFPYPYAERLGPPPGRYWSVDKLGGWRAGSWDYLPPRSGPAAWHCRHCASLELLP   1121 - 1190
PPRHLSCSHDGLDGGWWAPPPPPWAAGPLPRRRARCGCPRSHPHRPRASHRTPAAAAPHHHRHRRAAGGW   1191 - 1260
DLPPPAPTSRSLEDLSSCPRAAPARRLTGPSRHARRCPHAAHWGPPLPTASHRRHRGGDLGTRRGSAHFS   1261 - 1330
SLESEV                                                                   1331 - 1336
//

Text Mined References (40)

PMID Year Title
27616483 2016 GRIN2D Recurrent De Novo Dominant Mutation Causes a Severe Epileptic Encephalopathy Treatable with NMDA Receptor Channel Blockers.
22833210 2011 Rare mutations in N-methyl-D-aspartate glutamate receptors in autism spectrum disorders and schizophrenia.
22486492 2012 Pilot study of iPS-derived neural cells to examine biologic effects of alcohol on human neurons in vitro.
21915661 2011 [Chromosomal instability, microsatellite instability and CpG island methylator phenotype: roles in small intestinal carcinogenesis].
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19125103 2009 Association analysis of the glutamic acid decarboxylase 2 and the glutamine synthetase genes (GAD2, GLUL) with schizophrenia.
18444252 2008 Neurotransmission and bipolar disorder: a systematic family-based association study.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16328341 2006 Cultivated keratinocytes express N-methyl-D-aspartate receptors of the NMDAR2D type.
16094258 2005 Identification of single-nucleotide polymorphisms in the human N-methyl-D-aspartate receptor subunit NR2D gene, GRIN2D, and association study with schizophrenia.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14644469 2004 The human immunodeficiency virus type-1 transcription factor Tat produces elevations in intracellular Ca2+ that require function of an N-methyl-D-aspartate receptor polyamine-sensitive site.
14622581 2003 The NMDA receptor is coupled to the ERK pathway by a direct interaction between NR2B and RasGRF1.
12815021 2003 Activation of peripheral NMDA receptors contributes to human pain and rat afferent discharges evoked by injection of glutamate into the masseter muscle.
12775422 2003 Human immunodeficiency virus type 1 Tat protein directly activates neuronal N-methyl-D-aspartate receptors at an allosteric zinc-sensitive site.
12414113 2002 Neurotoxic effects of the human immunodeficiency virus type-1 transcription factor Tat require function of a polyamine sensitive-site on the N-methyl-D-aspartate receptor.
12191494 2002 Immunohistochemical localization of N-methyl-D-aspartate receptor subunits in the adult murine hippocampal formation: evidence for a unique role of the NR2D subunit.
12082569 2002 Determination of the genomic structure and mutation screening in schizophrenic individuals for five subunits of the N-methyl-D-aspartate glutamate receptor.
11937501 2002 Selectivity and promiscuity of the first and second PDZ domains of PSD-95 and synapse-associated protein 102.
11606043 2001 HIV-1 Tat causes apoptotic death and calcium homeostasis alterations in rat neurons.
11483648 2001 HIV-1 Tat through phosphorylation of NMDA receptors potentiates glutamate excitotoxicity.
10862698 2000 Proteomic analysis of NMDA receptor-adhesion protein signaling complexes.
10777567 2000 Interaction of the N-methyl-D-aspartic acid receptor NR2D subunit with the c-Abl tyrosine kinase.
10479680 1999 Neuronal interleukin-16 (NIL-16): a dual function PDZ domain protein.
10373510 1999 Ras-specific exchange factor GRF: oligomerization through its Dbl homology domain and calcium-dependent activation of Raf.
10216082 1999 Expression of a functional N-methyl-D-aspartate-type glutamate receptor by bone marrow megakaryocytes.
10197777 1999 Tat, a human immunodeficiency virus-1-derived protein, augments excitotoxic hippocampal injury in neonatal rats.
9651389 1998 HIV-1 Tat induces neuronal death via tumor necrosis factor-alpha and activation of non-N-methyl-D-aspartate receptors by a NFkappaB-independent mechanism.
9647694 1998 CIPP, a novel multivalent PDZ domain protein, selectively interacts with Kir4.0 family members, NMDA receptor subunits, neurexins, and neuroligins.
9489750 1998 Functional characterization of human N-methyl-D-aspartate subtype 1A/2D receptors.
9481670 1998 Adjacent asparagines in the NR2-subunit of the NMDA receptor channel control the voltage-dependent block by extracellular Mg2+.
9480759 1998 Localization of the human NMDAR2D receptor subunit gene (GRIN2D) to 19q13.1-qter, the NMDAR2A subunit gene to 16p13.2 (GRIN2A), and the NMDAR2C subunit gene (GRIN2C) to 17q24-q25 using somatic cell hybrid and radiation hybrid mapping panels.
9418891 1998 Isolation of estrogen-responsive genes with a CpG island library.
9258910 1997 Cellular distribution of NMDA glutamate receptor subunit mRNAs in the human cerebellum.
8665664 1995 Developmental rearrangements of cortical glutamate-NMDA receptor binding sites in late human gestation.
8615909 1996 Expression of Ca2+/calmodulin-dependent protein kinase types II and IV, and reduced DNA synthesis due to the Ca2+/calmodulin-dependent protein kinase inhibitor KN-62 (1-[N,O-bis(5-isoquinolinesulfonyl)-N-methyl-L-tyrosyl]-4-phenyl piperazine) in small cell lung carcinoma.
8613785 1996 Selective alterations in gene expression for NMDA receptor subunits in prefrontal cortex of schizophrenics.
7695237 1995 Human immunodeficiency virus type 1 tat activates non-N-methyl-D-aspartate excitatory amino acid receptors and causes neurotoxicity.
7569905 1995 Domain interaction between NMDA receptor subunits and the postsynaptic density protein PSD-95.