Property Summary

Ligand Count 6
NCBI Gene PubMed Count 161
PubMed Score 1158.10
PubTator Score 401.02

Knowledge Summary

Patent (14,768)

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Opiate dependence 29 0.0 5.0

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.400 1.5e-02
astrocytic glioma -2.900 5.4e-04
Astrocytoma, Pilocytic -2.000 5.3e-05
atypical teratoid / rhabdoid tumor -1.100 1.1e-02
ependymoma -1.700 5.3e-03
glioblastoma -1.900 1.5e-06
group 3 medulloblastoma -2.500 4.0e-03
lung carcinoma 2.500 1.2e-15
medulloblastoma, large-cell -4.000 5.7e-07
oligodendroglioma -2.500 2.6e-02
ovarian cancer 1.100 1.5e-08
Pick disease -1.100 3.6e-02
primitive neuroectodermal tumor -2.400 1.6e-05
psoriasis -1.500 5.3e-31
subependymal giant cell astrocytoma -1.801 3.2e-02

PDB (11)

Gene RIF (134)

AA Sequence

MGRVGYWTLLVLPALLVWRGPAPSAAAEKGPPALNIAVMLGHSHDVTERELRTLWGPEQAAGLPLDVNVV      1 - 70
ALLMNRTDPKSLITHVCDLMSGARIHGLVFGDDTDQEAVAQMLDFISSHTFVPILGIHGGASMIMADKDP     71 - 140
TSTFFQFGASIQQQATVMLKIMQDYDWHVFSLVTTIFPGYREFISFVKTTVDNSFVGWDMQNVITLDTSF    141 - 210
EDAKTQVQLKKIHSSVILLYCSKDEAVLILSEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLISVS    211 - 280
YDDWDYSLEARVRDGIGILTTAASSMLEKFSYIPEAKASCYGQMERPEVPMHTLHPFMVNVTWDGKDLSF    281 - 350
TEEGYQVHPRLVVIVLNKDREWEKVGKWENHTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVE    351 - 420
DIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVN    421 - 490
NVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVM    491 - 560
MFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQNPKGTTSKIM    561 - 630
VSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPY    631 - 700
MHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSP    701 - 770
WKRQIDLALLQFVGDGEMEELETLWLTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHL    771 - 840
FYWKLRFCFTGVCSDRPGLLFSISRGIYSCIHGVHIEEKKKSPDFNLTGSQSNMLKLLRSAKNISSMSNM    841 - 910
NSSRMDSPKRAADFIQRGSLIMDMVSDKGNLMYSDNRSFQGKESIFGDNMNELQTFVANRQKDNLNNYVF    911 - 980
QGQHPLTLNESNPNTVEVAVSTESKANSRPRQLWKKSVDSIRQDSLSQNPVSQRDEATAENRTHSLKSPR    981 - 1050
YLPEEMAHSDISETSNRATCHREPDNSKNHKTKDNFKRSVASKYPKDCSEVERTYLKTKSSSPRDKIYTI   1051 - 1120
DGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDSTLPMNRNPLHNEEGLSNNDQYKLYSKH   1121 - 1190
FTLKDKGSPHSETSERYRQNSTHCRSCLSNMPTYSGHFTMRSPFKCDACLRMGNLYDIDEDQMLQETGNP   1191 - 1260
ATGEQVYQQDWAQNNALQLQKNKLRISRQHSYDNIVDKPRELDLSRPSRSISLKDRERLLEGNFYGSLFS   1261 - 1330
VPSSKLSGKKSSLFPQGLEDSKRSKSLLPDHTSDNPFLHSHRDDQRLVIGRCPSDPYKHSLPSQAVNDSY   1331 - 1400
LRSSLRSTASYCSRDSRGHNDVYISEHVMPYAANKNNMYSTPRVLNSCSNRRVYKKMPSIESDV         1401 - 1464
//

Text Mined References (171)

PMID Year Title