Property Summary

Ligand Count 21
NCBI Gene PubMed Count 18
PubMed Score 127.26
PubTator Score 53.18

Knowledge Summary

Patent (6,027)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.100 5.0e-03
group 4 medulloblastoma 2.300 1.4e-04
lung carcinoma 1.600 4.5e-35
medulloblastoma, large-cell 1.400 4.3e-05
osteosarcoma 1.705 2.3e-06
psoriasis 2.100 1.0e-04
subependymal giant cell astrocytoma -1.215 3.7e-02

 GWAS Trait (1)

Gene RIF (7)

AA Sequence

MPAELLLLLIVAFASPSCQVLSSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAKARVEVDIFEL      1 - 70
QRDSQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKVGPEETPRLQYLRFASVSLYP     71 - 140
SNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRGFLISKETLSVRMLDDSRDPTPLLKEIRDDK    141 - 210
VSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEF    211 - 280
VRSLNMSWRENCEASTYLGPALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIWPHGTSLMNYL    281 - 350
RMVEYDGLTGRVEFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVT    351 - 420
TILENPYVMRRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGSWTGMVGELIN    421 - 490
RKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCV    491 - 560
LFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLI    561 - 630
IISSYTANLAAFLTVQRMEVPVESADDLADQTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSV    631 - 700
FVKSTEEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQ    701 - 770
ENNRLEILKRKWWEGGRCPKEEDHRAKGLGMENIGGIFIVLICGLIIAVFVAVMEFIWSTRRSAESEEVS    771 - 840
VCQEMLQELRHAVSCRKTSRSRRRRRPGGPSRALLSLRAVREMRLSNGKLYSAGAGGDAGSAHGGPQRLL    841 - 910
DDPGPPSGARPAAPTPCTHVRVCQECRRIQALRASGAGAPPRGLGVPAEATSPPRPRPGPAGPRELAEHE    911 - 980
//

Text Mined References (18)

PMID Year Title