Property Summary

NCBI Gene PubMed Count 27
PubMed Score 139.27
PubTator Score 74.43

Knowledge Summary

Patent (7,489)

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.100 1.2e-02
oligodendroglioma 1.300 6.8e-03
group 3 medulloblastoma 1.600 3.6e-04
pituitary cancer 1.200 6.4e-03
psoriasis -1.200 1.5e-19

Protein-protein Interaction (2)

Gene RIF (19)

PMID Text
26139080 Data suggest the involvement of glutamate receptor, ionotropic, kainate 4 protein (GRIK4) in treatment-resistant depression (TRD) and in the risk of developing psychotic symptoms during depressive episodes.
25303296 Subjects possessing the C allele or CC genotype of the GRIK4 polymorphism rs1954787 are more likely to respond to antidepressant treatment.
22052594 The deletion allele affords protection against bipolar disorder through increased KA1 protein abundance in neuronal cells.
21215464 Activation of kainate receptors could serve as a novel mechanism for enhancing B cell activation and immunoglobulin production.
20859245 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20110084 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19924111 The GRIK4 single nucleotide polymorphism (rs12800734) shows a strong association with disease remission in antidepressant treatment.
19924111 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19384319 This report provides the first evidence that genetic variation in the GRIK4 gene modulates hippocampal function.
19328558 Observational study of gene-disease association. (HuGE Navigator)
19125103 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18824690 An insertion/deletion (indel) variant in the 3' untranslated region (3'UTR) of the GRIK4 gene in subjects carrying the protective bipolar disorder haplotype was found.
18824690 Observational study of gene-disease association. (HuGE Navigator)
18289755 Observational study of gene-disease association. (HuGE Navigator)
16819533 Cytogenetic and genetic findings provide molecular evidence for common etiologies for schizophrenia and and bipolar disorder and further support the 'glutamate hypothesis' of psychotic illness.
16325263 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPRVSAPLVLLPAWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFE      1 - 70
LLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFKVAPEEFVKFQFQRFTTLNLH     71 - 140
PSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLRQFLISKDTLSVRMLDDTRDPTPLLKEIRDD    141 - 210
KTATIIIHANASMSHTILLKAAELGMVSAYYTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQE    211 - 280
FAQSLNQSWQENCDHVPFTGPALSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNY    281 - 350
LRMVELEGLTGHIEFNSKGQRSNYALKILQFTRNGFRQIGQWHVAEGLSMDSHLYASNISDTLFNTTLVV    351 - 420
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGTWTGMVGELI    421 - 490
ARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPGVWLFMLLAYLAVSC    491 - 560
VLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFPVGGFMQQGSTIAPRALSTRCVSGVWWAFTL    561 - 630
IIISSYTANLAAFLTVQRMDVPIESVDDLADQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPS    631 - 700
VFVKSTEEGIARVLNSNYAFLLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQL    701 - 770
QENNRLEILKRKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVS    771 - 840
VCQEMVTELRSIILCQDSIHPRRRRAAVPPPRPPIPEERRPRGTATLSNGKLCGAGEPDQLAQRLAQEAA    841 - 910
LVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWEKTTNSSEPE                            911 - 956
//

Text Mined References (28)

PMID Year Title
26139080 2015 The role of GRIK4 gene in treatment-resistant depression.
25303296 2014 GRIK4 polymorphism and its association with antidepressant response in depressed patients: a meta-analysis.
23728934 2013 Polygenic transmission and complex neuro developmental network for attention deficit hyperactivity disorder: genome-wide association study of both common and rare variants.
22052594 2012 GRIK4/KA1 protein expression in human brain and correlation with bipolar disorder risk variant status.
21215464 2011 Glutamate signaling through the kainate receptor enhances human immunoglobulin production.
20859245 2011 Glutamatergic gene variants impact the clinical profile of efficacy and side effects of haloperidol.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
20110084 2010 Failure to replicate genetic associations with antidepressant treatment response in duloxetine-treated patients.
19924111 2010 Polymorphisms in GRIK4, HTR2A, and FKBP5 show interactive effects in predicting remission to antidepressant treatment.
19384319 2009 A GRIK4 variant conferring protection against bipolar disorder modulates hippocampal function.
19342380 2009 Glutamate binding and conformational flexibility of ligand-binding domains are critical early determinants of efficient kainate receptor biogenesis.
19328558 2009 Case-control association study of 65 candidate genes revealed a possible association of a SNP of HTR5A to be a factor susceptible to bipolar disease in Bulgarian population.
19125103 2009 Association analysis of the glutamic acid decarboxylase 2 and the glutamine synthetase genes (GAD2, GLUL) with schizophrenia.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18824690 2008 A common variant in the 3'UTR of the GRIK4 glutamate receptor gene affects transcript abundance and protects against bipolar disorder.
18289755 2008 No genetic association between polymorphisms in the kainate-type glutamate receptor gene, GRIK4, and schizophrenia in the Chinese population.
16819533 2006 Cytogenetic and genetic evidence supports a role for the kainate-type glutamate receptor gene, GRIK4, in schizophrenia and bipolar disorder.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16325263 2006 Association study of polymorphisms in the GluR7, KA1 and KA2 kainate receptor genes (GRIK3, GRIK4, GRIK5) with schizophrenia.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12954862 2003 Distribution of kainate receptor subunits at hippocampal mossy fiber synapses.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11334999 2001 Ontogeny of ionotropic glutamate receptor expression in human fetal brain.
8288598 1994 Biochemical and assembly properties of GluR6 and KA2, two members of the kainate receptor family, determined with subunit-specific antibodies.
8263508 1994 Molecular cloning, expression, and pharmacological characterization of humEAA1, a human kainate receptor subunit.
7527545 1994 The genes encoding the glutamate receptor subunits KA1 and KA2 (GRIK4 and GRIK5) are located on separate chromosomes in human, mouse, and rat.