Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.3e-17

 GO Function (1)

 Compartment GO Term (0)

 GWAS Trait (1)

 HCA RNA Cell Line (3)

AA Sequence

MAVQSKAFCAGGLAPGWKLLVQGHADSGEDRFETNFLLETGDIAFHIKPRFSSATVVGNAFQYGRWGPEQ      1 - 70
VSSIFPLAPGEPFEIEVSWDAEHFHVYAPEHKVLQFPCRQRPLGATTRVRVLSDHCLAQVELAKRGLSWG     71 - 140
DRGY                                                                      141 - 144
//

Text Mined References (8)

PMID Year Title