Property Summary

NCBI Gene PubMed Count 26
PubMed Score 111.02
PubTator Score 14.72

Knowledge Summary

Patent (2,608)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 8.8e-07

Gene RIF (13)

PMID Text
26905411 Glutamate system genes including have been associated with disease risk in recent analyses from the Psychiatric Genomics Consortium.
25841024 GRID2 point mutations: cerebellar ataxia is the core phenotype, but with variable severity ranging from very mild adult-onset to congenital-onset linked to both the heterozygous and homozygous state of the variant, and the position of the mutation.
25146332 findings suggest a possible role of GRID2 in the susceptibility to develop mevalonate kinase deficiency. GRID2 gene associated with MKD: The rs1450500 SNP was differently distributed in patients with MKD with respect to those with recurrent fever.
25122145 We demonstrated for the first time GRID2 expression and localization in human and murine retina, providing evidence for a novel functional role of GRID2 in the retina.
24357660 GluD2 gating is triggered by type 1 metabotropic glutamate receptors.
24078737 GRID2 mutations are associated with a recessive syndrome causing cerebellar ataxia and eye movement abnormalities.
23512105 Tests for gene-environment interaction between these 33 genes and maternal smoking found evidence for interaction with two additional genes: GRID2 and ELAVL2 among European mothers
21368048 Glutamate receptor delta2 is involved in a common mechanism that restricts the number of synaptic AMPA receptors at parallel fiber synapses in cerebellar Purkinje cells.
20859245 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20487506 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18256267 The carboxy terminus of transgenic GluRdelta2 conveys the signal(s) necessary for long-term depression induction and motor learning.
17027646 Thus, phosphorylation of -2T and/or -1S of GluRdelta2 C-terminus by PKA may regulate the binding of GluRdelta2 to its scaffolding protein, Delphilin.

AA Sequence

MEVFPFLLVLSVWWSRTWDSANADSIIHIGAIFDESAKKDDEVFRTAVGDLNQNEEILQTEKITFSVTFV      1 - 70
DGNNPFQAVQEACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQRSTAGTPRSGCGLTRSNRND     71 - 140
DYTLSVRPPVYLHDVILRVVTEYAWQKFIIFYDSEYDIRGIQEFLDKVSQQGMDVALQKVENNINKMITT    141 - 210
LFDTMRIEELNRYRDTLRRAILVMNPATAKSFITEVVETNLVAFDCHWIIINEEINDVDVQELVRRSIGR    211 - 280
LTIIRQTFPVPQNISQRCFRGNHRISSTLCDPKDPFAQNMEISNLYIYDTVLLLANAFHKKLEDRKWHSM    281 - 350
ASLSCIRKNSKPWQGGRSMLETIKKGGVSGLTGELEFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWN    351 - 420
PVTGLNGSLTDKKLENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSNYLGFNYEIYV    421 - 490
APDHKYGSPQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSVGVLLRRAEKTVDMFA    491 - 560
CLAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSMTSTTLYNSMWFVYGSFVQQGGEVPYTTLAT    561 - 630
RMMMGAWWLFALIVISSYTANLAAFLTITRIESSIQSLQDLSKQTEIPYGTVLDSAVYEHVRMKGLNPFE    631 - 700
RDSMYSQMWRMINRSNGSENNVLESQAGIQKVKYGNYAFVWDAAVLEYVAINDPDCSFYTIGNTVADRGY    701 - 770
GIALQHGSPYRDVFSQRILELQQNGDMDILKHKWWPKNGQCDLYSSVDTKQKGGALDIKSFAGVFCILAA    771 - 840
GIVLSCFIAMLETWWNKRKGSRVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSIDLTPLDIDTL    841 - 910
PTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIK    911 - 980
TMSSIPYQPTPTLGLNLGNDPDRGTSI                                               981 - 1007
//

Text Mined References (28)

PMID Year Title
26905411 2016 Antipsychotic pharmacogenomics in first episode psychosis: a role for glutamate genes.
25841024 2015 GRID2 mutations span from congenital to mild adult-onset cerebellar ataxia.
25146332 2015 GRID2 a novel gene possibly associated with mevalonate kinase deficiency.
25122145 2015 Early-onset autosomal recessive cerebellar ataxia associated with retinal dystrophy: new human hotfoot phenotype caused by homozygous GRID2 deletion.
24357660 2014 Type 1 metabotropic glutamate receptors (mGlu1) trigger the gating of GluD2 delta glutamate receptors.
24078737 2013 Deletions in GRID2 lead to a recessive syndrome of cerebellar ataxia and tonic upgaze in humans.
23611888 2013 A homozygous deletion in GRID2 causes a human phenotype with cerebellar ataxia and atrophy.
23512105 2013 Confirming genes influencing risk to cleft lip with/without cleft palate in a case-parent trio study.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21368048 2011 Glutamate receptor ?2 is essential for input pathway-dependent regulation of synaptic AMPAR contents in cerebellar Purkinje cells.
20859245 2011 Glutamatergic gene variants impact the clinical profile of efficacy and side effects of haloperidol.
20487506 2010 A whole genome association study of mother-to-child transmission of HIV in Malawi.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18256267 2008 Differential regulation of synaptic plasticity and cerebellar motor learning by the C-terminal PDZ-binding motif of GluRdelta2.
17027646 2006 Binding of glutamate receptor delta2 to its scaffold protein, Delphilin, is regulated by PKA.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12589829 2003 PKC regulates the delta2 glutamate receptor interaction with S-SCAM/MAGI-2 protein.
12573530 2003 Heteromer formation of delta2 glutamate receptors with AMPA or kainate receptors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12372286 2002 A novel protein complex linking the delta 2 glutamate receptor and autophagy: implications for neurodegeneration in lurcher mice.
11829466 2002 Identification of rat EMAP, a delta-glutamate receptor binding protein.
10748123 2000 The protein-tyrosine phosphatase PTPMEG interacts with glutamate receptor delta 2 and epsilon subunits.
10234023 1999 Postsynaptic density-93 interacts with the delta2 glutamate receptor subunit at parallel fiber synapses.
9847074 1998 Toward a complete human genome sequence.
9465309 1998 The human glutamate receptor delta 2 gene (GRID2) maps to chromosome 4q22.
7506541 1993 Selective expression of the glutamate receptor channel delta 2 subunit in cerebellar Purkinje cells.