Property Summary

Ligand Count 40
NCBI Gene PubMed Count 55
PubMed Score 256.09
PubTator Score 107.05

Knowledge Summary

Patent (5,598)

TINX Plot

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -2.100 4.1e-04
astrocytic glioma 1.900 1.9e-02
Astrocytoma, Pilocytic 1.300 1.8e-04
atypical teratoid / rhabdoid tumor -4.300 9.4e-06
Breast cancer -1.500 8.6e-47
ependymoma 2.000 2.1e-02
gastric carcinoma -1.600 7.5e-03
glioblastoma -2.200 2.3e-04
group 3 medulloblastoma -1.200 1.0e-02
medulloblastoma, large-cell -1.300 1.2e-04
oligodendroglioma 2.500 2.9e-03
Pick disease -1.500 1.1e-02
pituitary cancer 1.400 1.5e-04
primitive neuroectodermal tumor -2.900 9.6e-03
psoriasis -1.700 3.0e-43
subependymal giant cell astrocytoma -2.679 2.7e-02

Protein-protein Interaction (2)

Gene RIF (29)

AA Sequence

MRIISRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDN      1 - 70
IETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRG     71 - 140
ALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFV    141 - 210
IDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLMDRWK    211 - 280
KLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLK    281 - 350
QVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT    351 - 420
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELV    421 - 490
YGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSV    491 - 560
VLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFF    561 - 630
TLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAE    631 - 700
PSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNL    701 - 770
AVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS    771 - 840
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASDLP            841 - 902
//

Text Mined References (57)

PMID Year Title