Property Summary

NCBI Gene PubMed Count 53
PubMed Score 246.00
PubTator Score 107.05

Knowledge Summary

Patent (5,598)

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma 1.900 1.9e-02
ependymoma -2.200 2.1e-03
oligodendroglioma 2.500 2.9e-03
glioblastoma -3.200 3.9e-03
group 4 medulloblastoma -5.200 5.7e-10
atypical teratoid / rhabdoid tumor -4.300 9.4e-06
medulloblastoma, large-cell -5.200 3.1e-07
primitive neuroectodermal tumor -2.900 9.6e-03
pediatric high grade glioma -2.600 2.3e-03
pilocytic astrocytoma 1.300 2.7e-04
subependymal giant cell astrocytoma -2.679 2.7e-02
Pick disease -1.500 1.1e-02
Breast cancer -1.500 8.6e-47
gastric carcinoma -1.600 7.5e-03
pituitary cancer 3.500 1.7e-05
psoriasis -1.700 3.0e-43

Gene RIF (27)

PMID Text
26744192 A transient positive feedback mechanism between AMPAR and stargazin has implications for information processing in the brain, because it should allow activity-dependent facilitation of excitatory synaptic transmission through a postsynaptic mechanism.
25433904 This study demonstrated that the GRIA4 protein was altered in auditory cortex patient with schizophreia.
24962026 Interaction with the alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor subunit GluR4.
24652293 The N-terminal domain modulates alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor desensitization.
24512576 Statistical analysis showed no association between migraine and the GRIA2 and GRIA4 polymorphisms investigated.
24292102 the levels were comparable for complexes containing GluR2, GluR3 and GluR4 as well as 5-HT1A. Moreover, the levels of complexes containing muscarinic AChR M1, NR1 and GluR1 were significantly increased in male patients with AD.
23613500 The data potentially suggest a lack of epistatic interaction between GRIA2 and GRIA4 variants regarding clinical outcomes in patients with major depressive disorder.
22122651 SNPs within GRIA4 may not be associated with the development and treatment outcomes in BD
22094384 No significant association GRIA4 polymorphisms was found with the diagnosis of schizophrenia.
22057216 Did not observed any significant association between GRIA4 polymorphisms and clinical improvement in patients with Major depressive disorder.
20859245 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19573479 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19125103 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18521090 Genome-wide association study of gene-disease association. (HuGE Navigator)
18163426 Of the three AMPA genes analyzed here, only GRIA3 seems to be involved in the pathogenesis of schizophrenia, but only in females.
18163426 Observational study of gene-disease association. (HuGE Navigator)
17233759 The present findings show that the interaction between PKCgamma and GluR4 is specifically required to assure PKC-driven phosphorylation and surface membrane expression of GluR4.
16190873 GluR4 may regulate its synaptic targeting through phosphorylation-dependent interactions with alpha-Actinin-1 and IQGAP1
15823042 The minimal kinetic mechanism for channel opening is consistent with binding of two glutamate molecules per receptor complex.
15450689 Observational study of gene-disease association. (HuGE Navigator)
15306133 alternative splicing isoform of GluR4, human GluR4c has a 113-bp insert containing a stop codon, resulting in a short C terminus.
12497607 Observational study of gene-disease association. (HuGE Navigator)
12497607 Results suggest that at least one susceptibility locus for schizophrenia is located within or very close to the GRIA4 region in Japanese.
12393905 characterization of homomeric alpha-amino-3-hydroxy-5-methylisoxazolepropionate (AMPA)-selective GluR-D glutamate receptors carrying N-terminal deletions
12125045 Flip and flop splice variants of AMPA receptor subunits in the spinal cord of amyotrophic lateral sclerosis.

AA Sequence

MRIISRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDN      1 - 70
IETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRG     71 - 140
ALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFV    141 - 210
IDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLMDRWK    211 - 280
KLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLK    281 - 350
QVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT    351 - 420
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELV    421 - 490
YGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSV    491 - 560
VLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFF    561 - 630
TLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAE    631 - 700
PSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNL    701 - 770
AVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS    771 - 840
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASDLP            841 - 902
//

Text Mined References (55)

PMID Year Title
26744192 2016 Superactivation of AMPA receptors by auxiliary proteins.
25433904 2015 Altered glutamate protein co-expression network topology linked to spine loss in the auditory cortex of schizophrenia.
24962026 2014 Neuronal pentraxin 2 supports clear cell renal cell carcinoma by activating the AMPA-selective glutamate receptor-4.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24652293 2014 The N-terminal domain modulates ?-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor desensitization.
24512576 2014 Genetic analysis of GRIA2 and GRIA4 genes in migraine.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24292102 2014 Changes of several brain receptor complexes in the cerebral cortex of patients with Alzheimer disease: probable new potential pharmaceutical targets.
23613500 2013 Investigation of possible epistatic interactions between GRIA2 and GRIA4 variants on clinical outcomes in patients with major depressive disorder.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
22122651 2012 Case-control association study of GRIA1, GRIA2 and GRIA4 polymorphisms in bipolar disorder.
22094384 2012 Influence of GRIA1, GRIA2 and GRIA4 polymorphisms on diagnosis and response to antipsychotic treatment in patients with schizophrenia.
22057216 2012 Influence of GRIA1, GRIA2 and GRIA4 polymorphisms on diagnosis and response to treatment in patients with major depressive disorder.
21984433 2012 Deregulation of the A-to-I RNA editing mechanism in psychiatric disorders.
21172611 2010 Hippocampal AMPA receptor gating controlled by both TARP and cornichon proteins.
20859245 2011 Glutamatergic gene variants impact the clinical profile of efficacy and side effects of haloperidol.
19573479 2009 Applicability of a genetic signature for enhanced iloperidone efficacy in the treatment of schizophrenia.
19217372 2009 Synaptic AMPA receptor plasticity and behavior.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19125103 2009 Association analysis of the glutamic acid decarboxylase 2 and the glutamine synthetase genes (GAD2, GLUL) with schizophrenia.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18521090 2009 Association of the NPAS3 gene and five other loci with response to the antipsychotic iloperidone identified in a whole genome association study.
18311135 2008 Motor protein-dependent transport of AMPA receptors into spines during long-term potentiation.
18163426 2008 Study on GRIA2, GRIA3 and GRIA4 genes highlights a positive association between schizophrenia and GRIA3 in female patients.
17409242 2007 Electrophysiological properties of AMPA receptors are differentially modulated depending on the associated member of the TARP family.
17233759 2007 PKC anchoring to GluR4 AMPA receptor subunit modulates PKC-driven receptor phosphorylation and surface expression.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16190873 2005 Phosphorylation-dependent interactions of alpha-Actinin-1/IQGAP1 with the AMPA receptor subunit GluR4.
16055064 2005 PICK1 interacts with ABP/GRIP to regulate AMPA receptor trafficking.
15823042 2005 Kinetic mechanism of channel opening of the GluRDflip AMPA receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15450689 2004 No genetic association between polymorphisms in the AMPA receptor subunit GluR4 gene (GRIA4) and schizophrenia in the Chinese population.
15306133 2004 GluR4c, an alternative splicing isoform of GluR4, is abundantly expressed in the adult human brain.
12603841 2003 Characterization of the functional role of the N-glycans in the AMPA receptor ligand-binding domain.
12574408 2003 Surface expression of GluR-D AMPA receptor is dependent on an interaction between its C-terminal domain and a 4.1 protein.
12497607 2003 Positive association of the AMPA receptor subunit GluR4 gene (GRIA4) haplotype with schizophrenia: linkage disequilibrium mapping using SNPs evenly distributed across the gene region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471040 2003 Protein kinase C gamma associates directly with the GluR4 alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate receptor subunit. Effect on receptor phosphorylation.
12393905 2002 Alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor channels lacking the N-terminal domain.
12172541 2002 Blockage of Ca(2+)-permeable AMPA receptors suppresses migration and induces apoptosis in human glioblastoma cells.
12125045 2002 Flip and flop splice variants of AMPA receptor subunits in the spinal cord of amyotrophic lateral sclerosis.
11891216 2002 The PDZ proteins PICK1, GRIP, and syntenin bind multiple glutamate receptor subtypes. Analysis of PDZ binding motifs.
11140673 2000 Stargazin regulates synaptic targeting of AMPA receptors by two distinct mechanisms.
10688364 2000 A phylogenetic analysis reveals an unusual sequence conservation within introns involved in RNA editing.
10366608 1999 Characterization of phosphorylation sites on the glutamate receptor 4 subunit of the AMPA receptors.
9648857 1998 AMPA receptor-mediated excitotoxicity in human NT2-N neurons results from loss of intracellular Ca2+ homeostasis following marked elevation of intracellular Na+.
9481670 1998 Adjacent asparagines in the NR2-subunit of the NMDA receptor channel control the voltage-dependent block by extracellular Mg2+.
9466455 1998 Expression and heteromeric interactions of non-N-methyl-D-aspartate glutamate receptor subunits in the developing and adult cerebellum.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8589990 1995 Cloning, expression and pharmacological characterization of a human glutamate receptor: hGluR4.
8163463 1994 Transmembrane topology of the glutamate receptor subunit GluR6.
7992055 1994 Control of kinetic properties of AMPA receptor channels by nuclear RNA editing.
7518497 1994 Expression of non-NMDA glutamate receptor channel genes by clonal human neurons.
1319477 1992 Chromosomal localization of human glutamate receptor genes.