Property Summary

Ligand Count 21
NCBI Gene PubMed Count 59
PubMed Score 91.92
PubTator Score 113.94

Knowledge Summary

Patent (9,167)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Vascular disease 319 0.0 0.9
Disease Target Count Z-score Confidence
Major Depressive Disorder 301 3.388 1.7
Epilepsy 792 3.082 1.5

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.100 8.3e-03
astrocytic glioma 1.500 4.3e-03
atypical teratoid / rhabdoid tumor -3.200 6.5e-10
ependymoma -2.100 5.4e-07
gastric carcinoma -1.200 1.6e-02
glioblastoma -1.300 2.6e-02
group 3 medulloblastoma -2.100 5.9e-04
lung carcinoma 1.400 2.5e-10
medulloblastoma, large-cell -3.600 1.8e-06
oligodendroglioma 1.200 2.3e-02
osteosarcoma 1.381 1.7e-02
ovarian cancer -2.300 1.6e-07
Pick disease -1.700 1.8e-02
primitive neuroectodermal tumor -2.400 1.9e-03

Gene RIF (34)

AA Sequence

MARQKKMGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNTNQNTTEKPFH      1 - 70
LNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGALHTSFVTPSFPTDADVQFVIQ     71 - 140
MRPALKGAILSLLGHYKWEKFVYLYDTERGFSILQAIMEAAVQNNWQVTARSVGNIKDVQEFRRIIEEMD    141 - 210
RRQEKRYLIDCEVERINTILEQVVILGKHSRGYHYMLANLGFTDILLERVMHGGANITGFQIVNNENPMV    211 - 280
QQFIQRWVRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQ    281 - 350
GIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASS    351 - 420
ENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPETKIW    421 - 490
NGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIV    491 - 560
FAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSG    561 - 630
RIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYE    631 - 700
KMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPK    701 - 770
GSALRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMM    771 - 840
VALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI                    841 - 894
//

Text Mined References (59)

PMID Year Title