Property Summary

NCBI Gene PubMed Count 57
PubMed Score 83.68
PubTator Score 113.94

Knowledge Summary

Patent (9,167)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 1.500 4.3e-03
oligodendroglioma 1.200 2.3e-02
osteosarcoma 1.381 1.7e-02
ependymoma -2.700 1.3e-06
medulloblastoma -5.200 4.3e-10
atypical teratoid / rhabdoid tumor -5.100 6.5e-10
glioblastoma -2.100 8.3e-03
medulloblastoma, large-cell -5.500 1.8e-06
primitive neuroectodermal tumor -3.500 1.3e-03
adult high grade glioma -1.100 8.3e-03
lung carcinoma 1.400 2.5e-10
Pick disease -1.700 1.8e-02
gastric carcinoma -1.200 1.6e-02
ovarian cancer -2.300 1.6e-07

Gene RIF (32)

PMID Text
26912664 the impaired surface expression of homomeric GluA3 receptors is caused by nonproductive assembly and aggregation to which LBD residues Tyr-454 and Arg-461 strongly contribute.
25613138 The gene expression of glutamate receptor 3 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25433904 This study demonstrated that the GRIA3 protein was altered in auditory cortex patient with schizophreia.
24652293 The N-terminal domain modulates alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor desensitization.
24292102 the levels were comparable for complexes containing GluR2, GluR3 and GluR4 as well as 5-HT1A. Moreover, the levels of complexes containing muscarinic AChR M1, NR1 and GluR1 were significantly increased in male patients with AD.
23772601 An association was observed in migraine patients with the GRIA3 single nucleotide polymorphism rs3761555.
23595422 The ionotrophic glutamate receptors AMPA3 and AMPA3 were decreased in hippocampus in patient with multiple sclerosis.
23149219 the promoter methylation of the GMR2 and GMR5 genes greatly decreased the risk of schizophrenia, and the expression level of the GRM2, GRM5, and GRIA3 genes increased significantly in patients in comparison to healthy controls.
22429480 The rs557762 and the TT haplotype in the 11th haplotype block of the GRIA3 gene were associated with feelings of guilt in females.
21966062 SNP rs687577 associated with sleep duration and depression risk in Finnish women
20859245 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20689760 GRIA3 plays a role as a mediator of tumor progression in pancreatic cancer downstream CUX1.
20579352 Two variants in the regulative regions of GRIA1 (rs2195450) and GRIA3 (rs3761555) genes resulted strongly associated with MA (P = 0.00002 and P = 0.0001, respectively), but not associated with MO
20579352 Observational study of gene-disease association. (HuGE Navigator)
20564826 AQP3 gene isn't the responsible gene for this pedigree with auditory neuropathy.
19945495 This study demonistrated that the level of metabotropic glutamate receptor 2/3 is elevated in the prefrontal cortex in patient of major depression disorder.
19933774 The mGlu3 receptor is located on a number of GABAergic interneurons throughout the brain. mGlu3 receptor is one of two primary mGlu receptors that modulate the function of glia. The mGlu3 receptor is present as a postsynaptic receptor as well.
19736351 Observational study of gene-disease association. (HuGE Navigator)
19548263 Observational study of gene-disease association. (HuGE Navigator)
19449417 Aberrant GRIA3 transcripts with multi-exon duplications in a family with X-linked mental retardation are reported.
19295509 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18593792 results support the involvement of genes GRIA3 and GRIK2 in antidepressant treatment-emergent suicidal ideation
18163426 Of the three AMPA genes analyzed here, only GRIA3 seems to be involved in the pathogenesis of schizophrenia, but only in females.
18163426 Observational study of gene-disease association. (HuGE Navigator)
17989220 study provides the genetic and functional evidence that mutant iGluR3 with altered kinetic properties is associated with moderate cognitive impairment in humans
17202328 cleavage and release to the extracellular milieu of the GluR3B peptide may in principle increase its antigenicity
15145077 cell loss and up-regulation of glutamate receptor subunits appear early in temporal lobe epilepsy and contribute to the synaptic plasticity that may facilitate the subsequent sprouting of mossy fiber collaterals
15144856 This study investigated whether the AMPA receptor subunit content (GluR1, GluR2, GluR2/3) within "vulnerable" vs. "resistant" sectors of the hippocampus is quantitatively altered with increasing Alzheimer Disease neuropathology
12682273 T lymphocytes from normal individuals, an alloprimed human T cell clone, and human T leukemia (Jurkat) cells all express high levels of GluR3, identical in sequence with brain GluR3.
12125045 Flip and flop splice variants of AMPA receptor subunits in the spinal cord of amyotrophic lateral sclerosis.

AA Sequence

MARQKKMGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNTNQNTTEKPFH      1 - 70
LNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGALHTSFVTPSFPTDADVQFVIQ     71 - 140
MRPALKGAILSLLGHYKWEKFVYLYDTERGFSILQAIMEAAVQNNWQVTARSVGNIKDVQEFRRIIEEMD    141 - 210
RRQEKRYLIDCEVERINTILEQVVILGKHSRGYHYMLANLGFTDILLERVMHGGANITGFQIVNNENPMV    211 - 280
QQFIQRWVRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQ    281 - 350
GIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASS    351 - 420
ENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPETKIW    421 - 490
NGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIV    491 - 560
FAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSG    561 - 630
RIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYE    631 - 700
KMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPK    701 - 770
GSALRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMM    771 - 840
VALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI                    841 - 894
//

Text Mined References (57)

PMID Year Title
26912664 2016 Aggregation Limits Surface Expression of Homomeric GluA3 Receptors.
25433904 2015 Altered glutamate protein co-expression network topology linked to spine loss in the auditory cortex of schizophrenia.
24652293 2014 The N-terminal domain modulates ?-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor desensitization.
24292102 2014 Changes of several brain receptor complexes in the cerebral cortex of patients with Alzheimer disease: probable new potential pharmaceutical targets.
23772601 2013 Association of a GRIA3 gene polymorphism with migraine in an Australian case-control cohort.
23595422 2013 Hippocampal demyelination and memory dysfunction are associated with increased levels of the neuronal microRNA miR-124 and reduced AMPA receptors.
23149219 2013 Evaluation of hypermethylation and expression pattern of GMR2, GMR5, GMR8, and GRIA3 in patients with schizophrenia.
22429480 2012 Genetic association study of individual symptoms in depression.
21966062 2011 Shared genetic background for regulation of mood and sleep: association of GRIA3 with sleep duration in healthy Finnish women.
21172611 2010 Hippocampal AMPA receptor gating controlled by both TARP and cornichon proteins.
20859245 2011 Glutamatergic gene variants impact the clinical profile of efficacy and side effects of haloperidol.
20689760 2010 Glutamate receptor GRIA3--target of CUX1 and mediator of tumor progression in pancreatic cancer.
20579352 2010 Common variants in the regulative regions of GRIA1 and GRIA3 receptor genes are associated with migraine susceptibility.
20564826 2010 [Analyzing GRIA3 gene mutations located in AUNX1 locus in a Chinese pedigree with auditory neuropathy].
19945495 2010 Elevated level of metabotropic glutamate receptor 2/3 in the prefrontal cortex in major depression.
19933774 2010 Glutamatergic (N-methyl-D-aspartate receptor) hypofrontality in schizophrenia: too little juice or a miswired brain?
19736351 2009 Recurrent rearrangements in synaptic and neurodevelopmental genes and shared biologic pathways in schizophrenia, autism, and mental retardation.
19548263 2010 A population-based association study of candidate genes for depression and sleep disturbance.
19449417 2009 Aberrant GRIA3 transcripts with multi-exon duplications in a family with X-linked mental retardation.
19295509 2009 Genetic and clinical predictors of sexual dysfunction in citalopram-treated depressed patients.
19217372 2009 Synaptic AMPA receptor plasticity and behavior.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18593792 2008 Genetic markers within glutamate receptors associated with antidepressant treatment-emergent suicidal ideation.
18311135 2008 Motor protein-dependent transport of AMPA receptors into spines during long-term potentiation.
18163426 2008 Study on GRIA2, GRIA3 and GRIA4 genes highlights a positive association between schizophrenia and GRIA3 in female patients.
17989220 2007 Mutations in ionotropic AMPA receptor 3 alter channel properties and are associated with moderate cognitive impairment in humans.
17409242 2007 Electrophysiological properties of AMPA receptors are differentially modulated depending on the associated member of the TARP family.
17202328 2007 TCR activation eliminates glutamate receptor GluR3 from the cell surface of normal human T cells, via an autocrine/paracrine granzyme B-mediated proteolytic cleavage.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16055064 2005 PICK1 interacts with ABP/GRIP to regulate AMPA receptor trafficking.
15772651 2005 The DNA sequence of the human X chromosome.
15145077 2004 AMPA receptor alterations precede mossy fiber sprouting in young children with temporal lobe epilepsy.
15144856 2004 Differential preservation of AMPA receptor subunits in the hippocampi of Alzheimer's disease patients according to Braak stage.
14687553 2003 Glutamatergic plasticity by synaptic delivery of GluR-B(long)-containing AMPA receptors.
14663150 2003 Protein phosphatase 2C binds selectively to and dephosphorylates metabotropic glutamate receptor 3.
12682273 2003 Human T cells express a functional ionotropic glutamate receptor GluR3, and glutamate by itself triggers integrin-mediated adhesion to laminin and fibronectin and chemotactic migration.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12172541 2002 Blockage of Ca(2+)-permeable AMPA receptors suppresses migration and induces apoptosis in human glioblastoma cells.
12125045 2002 Flip and flop splice variants of AMPA receptor subunits in the spinal cord of amyotrophic lateral sclerosis.
11931740 2002 Interaction between GRIP and liprin-alpha/SYD2 is required for AMPA receptor targeting.
11891216 2002 The PDZ proteins PICK1, GRIP, and syntenin bind multiple glutamate receptor subtypes. Analysis of PDZ binding motifs.
11725645 2001 [Linkage analysis and mutation detection of GRIA3 in Smith--Fineman--Myers syndrome].
11160179 2001 Granzyme B proteolysis of a neuronal glutamate receptor generates an autoantigen and is modulated by glycosylation.
10688364 2000 A phylogenetic analysis reveals an unusual sequence conservation within introns involved in RNA editing.
10644433 1999 Characterization of the human glutamate receptor subunit 3 gene (GRIA3), a candidate for bipolar disorder and nonspecific X-linked mental retardation.
10602120 2000 Candidate gene analysis in Rett syndrome and the identification of 21 SNPs in Xq.
9892356 1999 The AMPA receptor interacts with and signals through the protein tyrosine kinase Lyn.
9697855 1998 The AMPA receptor GluR2 C terminus can mediate a reversible, ATP-dependent interaction with NSF and alpha- and beta-SNAPs.
9648857 1998 AMPA receptor-mediated excitotoxicity in human NT2-N neurons results from loss of intracellular Ca2+ homeostasis following marked elevation of intracellular Na+.
9481670 1998 Adjacent asparagines in the NR2-subunit of the NMDA receptor channel control the voltage-dependent block by extracellular Mg2+.
8951883 1996 Differential regional distribution of AMPA receptor subunit messenger RNAs in the human spinal cord as visualized by in situ hybridization.
8036512 1994 Autoantibodies to glutamate receptor GluR3 in Rasmussen's encephalitis.
7918660 1994 Human glutamate receptor hGluR3 flip and flop isoforms: cloning and sequencing of the cDNAs and primary structure of the proteins.
1709304 1991 Ca2+ permeability of KA-AMPA--gated glutamate receptor channels depends on subunit composition.
1319477 1992 Chromosomal localization of human glutamate receptor genes.