Property Summary

NCBI Gene PubMed Count 81
PubMed Score 422.27
PubTator Score 543.57

Knowledge Summary

Patent (16,139)

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma -3.800 1.8e-04
posterior fossa group A ependymoma -5.000 3.1e-12
atypical teratoid / rhabdoid tumor -4.600 3.9e-04
medulloblastoma, large-cell -3.600 2.0e-07
pediatric high grade glioma -2.500 3.6e-03
psoriasis -1.600 1.4e-09
lung carcinoma 5.700 8.8e-53
pituitary cancer 1.300 3.2e-04

 CSPA Cell Line (1)

Protein-protein Interaction (3)

Gene RIF (56)

PMID Text
26744192 A transient positive feedback mechanism between AMPAR and stargazin has implications for information processing in the brain, because it should allow activity-dependent facilitation of excitatory synaptic transmission through a postsynaptic mechanism.
26311781 The GluR2 subunit of the AMPA receptor is involved in cell migration and calcium signaling.
25842862 GRIA2*CCC polymorphism is genetic risk marker for paranoid schizophrenia in Russians.Low risk genetic markers of paranoid schizophrenia were revealed: in Tatars-GRIA2*T/T (rs43025506) of GRIA2 gene and GRIA2*CCT in Russians.
25784538 RAB39B selectively regulates GluA2 trafficking to determine synaptic AMPAR composition
24679603 a link between neurodegenerative processes and deficient RNA editing of the GluA2 Q/R site.
24652293 The N-terminal domain modulates alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor desensitization.
24623784 We show that excitatory cortical-patterned neurons derived from multiple human pluripotent stem cell lines exhibit native-like maturation changes in AMPAR composition such that there is an increase in the expression of GluA2(R) subunits.
24550387 analysis of changes in receptor kinetics with the R628E charge-inverting mutation in the "linker" region of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor
24512576 Statistical analysis showed no association between migraine and the GRIA2 and GRIA4 polymorphisms investigated.
24456377 GRIA2 is a useful marker for distinguishing solitary fibrous tumour from most mimics
24292102 the levels were comparable for complexes containing GluR2, GluR3 and GluR4 as well as 5-HT1A. Moreover, the levels of complexes containing muscarinic AChR M1, NR1 and GluR1 were significantly increased in male patients with AD.
23613500 The data potentially suggest a lack of epistatic interaction between GRIA2 and GRIA4 variants regarding clinical outcomes in patients with major depressive disorder.
23595422 The ionotrophic glutamate receptors AMPA2 and AMPA3 were decreased in hippocampus in patient with multiple sclerosis.
23475111 Studies indicate that AMPAR trafficking is a key mechanism that drives nascent synapse development, and is the main determinant of both Hebbian and homeostatic plasticity in mature synapses.
22644307 We demonstrated that the expression of GRIA2 among the differentially expressed genes provides better prognosis of patients with advanced serous papillary ovarian adenocarcinoma.
22366356 ADAR2 expression level reflects editing activity at the GluA2 Q/R site; although the edited GluA2 pre-mRNA is readily spliced, the unedited GluA2 pre-mRNA is also spliced and transported to the cytoplasm when ADAR2 expression is low.
22122651 SNPs within GRIA2 may not be associated with the development and treatment outcomes in BD
22094384 significant association GRIA2 polymorphisms was found with the diagnosis of schizophrenia.
22057216 Did not observed significant association between GRIA2 polymorphisms and clinical improvement in patients with Major depressive disorder.But rs4302506 and rs4403097 single nucleotide polymorphisms could be associated with age of onset of the disease.
21948504 the GluR2 gene is embedded into an open chromatin configuration in glioma cells and expression of GluR2 is controlled by REST and Sp1
21856433 AMPA receptor regulation during synaptic plasticity in hippocampus and neocortex
21843653 New insights in endosomal dynamics and AMPA receptor trafficking
21397006 The balance of expression of nerve growth factor (NGF) and that of its receptors shifts toward cell death mechanisms during the progression of Alzheimer disease.
21383172 Gain-of-function glutamate receptor interacting protein 1 variants alter GluA2 recycling and surface distribution in patients with autism
21221849 Data show that CALM influences the cell surface level of the AMPA receptor subunit GluR2.
21173224 Transsynaptic signaling mediated by the extracellular domain of GluR2 regulates the stability of presynaptic terminals.
20468064 Observational study of gene-disease association. (HuGE Navigator)
20409611 We conclude that polymorphisms in the GluR2 gene (GRIA2) are not a major contributory factor in the pathogenesis of ALS.
20409611 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20347265 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19933774 [review] The importance of mGlu2/3 glutamate receptors during normal central nervous system development is likely to play an important mechanistic role in the neurodevelopmental hypothesis of schizophrenia.
19651138 This dimeric structure provides a mechanism for how the ATDs can drive receptor assembly and subtype-restricted composition.
19558602 These findings indicate that the absence of the GluR2 subunit favours malignancy in gliomas
19448189 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19102704 the GluR4 subunit exhibits a different correlation between receptor activation and ligand-binding domain cleft closure than does GluR2
19086053 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of glutamate receptor, ionotropic, AMPA 2 (GRIA2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18403631 utilized reverse-transcription polymerase chain reaction and BbvI digestion to demonstrate that neural progenitor cells contain Q/R-unedited GluR2, and differentiated cells contain Q/R-edited GluR2 subunits
18163426 Of the three AMPA genes analyzed here, only GRIA3 seems to be involved in the pathogenesis of schizophrenia, but only in females.
18163426 Observational study of gene-disease association. (HuGE Navigator)
17942280 Laser capture microdissection combined with quantitative PCR was used to examine the expression of AMPA (GRIA1-4) and NMDA (GRIN1, 2A and 2B) subunit mRNA levels in Layer II/III and Layer V pyramidal cells
16215279 Circumstance data have indicated that the GluR2 subunits dictate Ca2+/Zn2+ permeability of AMPA receptor channels and gate injurious Ca2+/Zn2+ signals in vulnerable neurons.
16045445 GluR2 was localized to the perikarya and proximal dendrites of BLA neurons; dense labeling was also present over the pyramidal cell layer of hippocampal subfields CA1 and CA3
15145077 cell loss and up-regulation of glutamate receptor subunits appear early in temporal lobe epilepsy and contribute to the synaptic plasticity that may facilitate the subsequent sprouting of mossy fiber collaterals
15144856 This study investigated whether the AMPA receptor subunit content (GluR1, GluR2, GluR2/3) within "vulnerable" vs. "resistant" sectors of the hippocampus is quantitatively altered with increasing Alzheimer Disease neuropathology
15071096 Control of GLUR2 translation was mediated by a sequence containing a 34-42 nucleotide imperfect GU repeat predicted to form secondary structure in vivo. This translation suppression domain is included in some rat and human GluR2 transcripts in vivo
15006707 R/G editing status: the relative amount of edited GLUR2 mRNA was increased in epileptic hippocampi, whereas no changes were found in neocortical tissues.
14985749 There is a defect in the editing of the mRNA encoding the GluR2 subunit of glutamate AMPA receptors in the spinal motor neurons of individuals affected by amyotrophic lateral sclerosis
14630051 GluR2, a subunit of a ligand-gated cation channel, is up-regulated in leiomyomata relative to myometrium by 15- to 30-fold at the protein and mRNA level and is localized in endothelial cells
12859334 the Q/R site of GluRs editing is regulated in a regional manner and the GluR2 Q/R site editing is critically regulated by ADAR2 in human brain
12694394 Low levels of GluR2 mRNA in motoneurons of ALS did not differ from the control group, implying that selective reduction of the GluR2 subunit cannot be a mechanism of AMPA receptor-mediated neurotoxicity in ALS
12130635 role of interaction with N-ethylmaleimide-sensitive factor in regulation of AMPA receptors by brain-derived neurotrophic factor
12125045 Flip and flop splice variants of AMPA receptor subunits in the spinal cord of amyotrophic lateral sclerosis.
11860506 Post-transcriptional editing of this subunit at the Q/R/N site controls calcium permeability

AA Sequence

MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANS      1 - 70
FAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLI     71 - 140
EYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILD    141 - 210
CERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTL    211 - 280
EEKEYPGAHTTTIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQ    281 - 350
VQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT    351 - 420
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVY    421 - 490
GKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVV    491 - 560
LFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFT    561 - 630
LIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEP    631 - 700
SVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLA    701 - 770
VLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR    771 - 840
AEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI                               841 - 883
//

Text Mined References (86)

PMID Year Title
26744192 2016 Superactivation of AMPA receptors by auxiliary proteins.
26311781 2015 Myelin Proteolipid Protein Complexes with ?v Integrin and AMPA Receptors In Vivo and Regulates AMPA-Dependent Oligodendrocyte Progenitor Cell Migration through the Modulation of Cell-Surface GluR2 Expression.
25842862 [Glutamate receptors genes polymorphism and the risk of paranoid schizophrenia in Russians and tatars from the Republic of Bashkortostan].
25784538 2015 The intellectual disability protein RAB39B selectively regulates GluA2 trafficking to determine synaptic AMPAR composition.
24679603 2014 Hippocampus-specific deficiency in RNA editing of GluA2 in Alzheimer's disease.
24652293 2014 The N-terminal domain modulates ?-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor desensitization.
24623784 2014 Maturation of AMPAR composition and the GABAAR reversal potential in hPSC-derived cortical neurons.
24550387 2014 A charge-inverting mutation in the "linker" region of ?-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors alters agonist binding and gating kinetics independently of allosteric modulators.
24512576 2014 Genetic analysis of GRIA2 and GRIA4 genes in migraine.
24456377 2014 GRIA2 is a novel diagnostic marker for solitary fibrous tumour identified through gene expression profiling.
24292102 2014 Changes of several brain receptor complexes in the cerebral cortex of patients with Alzheimer disease: probable new potential pharmaceutical targets.
23739980 2013 A eukaryotic specific transmembrane segment is required for tetramerization in AMPA receptors.
23613500 2013 Investigation of possible epistatic interactions between GRIA2 and GRIA4 variants on clinical outcomes in patients with major depressive disorder.
23595422 2013 Hippocampal demyelination and memory dysfunction are associated with increased levels of the neuronal microRNA miR-124 and reduced AMPA receptors.
23475111 2013 AMPAR trafficking in synapse maturation and plasticity.
22644307 2012 Identification of differentially expressed genes according to chemosensitivity in advanced ovarian serous adenocarcinomas: expression of GRIA2 predicts better survival.
22366356 2012 RNA editing of the Q/R site of GluA2 in different cultured cell lines that constitutively express different levels of RNA editing enzyme ADAR2.
22122651 2012 Case-control association study of GRIA1, GRIA2 and GRIA4 polymorphisms in bipolar disorder.
22094384 2012 Influence of GRIA1, GRIA2 and GRIA4 polymorphisms on diagnosis and response to antipsychotic treatment in patients with schizophrenia.
22057216 2012 Influence of GRIA1, GRIA2 and GRIA4 polymorphisms on diagnosis and response to treatment in patients with major depressive disorder.
21984433 2012 Deregulation of the A-to-I RNA editing mechanism in psychiatric disorders.
21948504 2012 Chromatin structure and expression of the AMPA receptor subunit Glur2 in human glioma cells: major regulatory role of REST and Sp1.
21856433 2011 AMPA receptor regulation during synaptic plasticity in hippocampus and neocortex.
21843653 2011 New insights in endosomal dynamics and AMPA receptor trafficking.
21531559 2011 Quinazolinedione sulfonamides: a novel class of competitive AMPA receptor antagonists with oral activity.
21397006 2011 Gender differences in neurotrophin and glutamate receptor expression in cholinergic nucleus basalis neurons during the progression of Alzheimer's disease.
21383172 2011 Gain-of-function glutamate receptor interacting protein 1 variants alter GluA2 recycling and surface distribution in patients with autism.
21221849 2011 CALM, a clathrin assembly protein, influences cell surface GluR2 abundance.
21173224 2011 Regulation of synaptic stability by AMPA receptor reverse signaling.
20614889 2010 Discovery of N-[(2S)-5-(6-fluoro-3-pyridinyl)-2,3-dihydro-1H-inden-2-yl]-2-propanesulfonamide, a novel clinical AMPA receptor positive modulator.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20409611 2012 Polymorphisms in the GluR2 gene are not associated with amyotrophic lateral sclerosis.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
20347265 2010 MicroRNAs and target site screening reveals a pre-microRNA-30e variant associated with schizophrenia.
19933774 2010 Glutamatergic (N-methyl-D-aspartate receptor) hypofrontality in schizophrenia: too little juice or a miswired brain?
19651138 2009 Crystal structure of the GluR2 amino-terminal domain provides insights into the architecture and assembly of ionotropic glutamate receptors.
19558602 2009 The GluR2 subunit inhibits proliferation by inactivating Src-MAPK signalling and induces apoptosis by means of caspase 3/6-dependent activation in glioma cells.
19448189 2009 A genomewide association study of response to lithium for prevention of recurrence in bipolar disorder.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19102704 2008 Correlating AMPA receptor activation and cleft closure across subunits: crystal structures of the GluR4 ligand-binding domain in complex with full and partial agonists.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18403631 2008 Calcium-permeable AMPA receptors containing Q/R-unedited GluR2 direct human neural progenitor cell differentiation to neurons.
18163426 2008 Study on GRIA2, GRIA3 and GRIA4 genes highlights a positive association between schizophrenia and GRIA3 in female patients.
17942280 2007 Elevated GRIA1 mRNA expression in Layer II/III and V pyramidal cells of the DLPFC in schizophrenia.
17409242 2007 Electrophysiological properties of AMPA receptors are differentially modulated depending on the associated member of the TARP family.
16724110 2006 Coordinated action of NSF and PKC regulates GABAB receptor signaling efficacy.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16215279 2005 AMPA receptor subunit GluR2 gates injurious signals in ischemic stroke.
16055064 2005 PICK1 interacts with ABP/GRIP to regulate AMPA receptor trafficking.
16045445 2005 Evidence for low GluR2 AMPA receptor subunit expression at synapses in the rat basolateral amygdala.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15247289 2004 The PDZ domain of PICK1 differentially accepts protein kinase C-alpha and GluR2 as interacting ligands.
15145077 2004 AMPA receptor alterations precede mossy fiber sprouting in young children with temporal lobe epilepsy.
15144856 2004 Differential preservation of AMPA receptor subunits in the hippocampi of Alzheimer's disease patients according to Braak stage.
15071096 2004 Inhibition of glutamate receptor 2 translation by a polymorphic repeat sequence in the 5'-untranslated leaders.
15006707 2004 RNA editing (R/G site) and flip-flop splicing of the AMPA receptor subunit GluR2 in nervous tissue of epilepsy patients.
14985749 2004 Glutamate receptors: RNA editing and death of motor neurons.
14687553 2003 Glutamatergic plasticity by synaptic delivery of GluR-B(long)-containing AMPA receptors.
14630051 2003 New potential regulators of uterine leiomyomata from DNA arrays: the ionotropic glutamate receptor GluR2.
12859334 2003 Low editing efficiency of GluR2 mRNA is associated with a low relative abundance of ADAR2 mRNA in white matter of normal human brain.
12805550 2003 Requirement of AMPA receptor GluR2 phosphorylation for cerebellar long-term depression.
12694394 2003 Human spinal motoneurons express low relative abundance of GluR2 mRNA: an implication for excitotoxicity in ALS.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12130635 2002 Brain-derived neurotrophic factor regulates surface expression of alpha-amino-3-hydroxy-5-methyl-4-isoxazoleproprionic acid receptors by enhancing the N-ethylmaleimide-sensitive factor/GluR2 interaction in developing neocortical neurons.
12125045 2002 Flip and flop splice variants of AMPA receptor subunits in the spinal cord of amyotrophic lateral sclerosis.
12062022 2002 RNA editing at arg607 controls AMPA receptor exit from the endoplasmic reticulum.
11931740 2002 Interaction between GRIP and liprin-alpha/SYD2 is required for AMPA receptor targeting.
11086992 2000 Mechanisms for activation and antagonism of an AMPA-sensitive glutamate receptor: crystal structures of the GluR2 ligand binding core.
11007883 2000 Phosphorylation of the AMPA receptor subunit GluR2 differentially regulates its interaction with PDZ domain-containing proteins.
10985351 2000 Mutagenesis reveals a role for ABP/GRIP binding to GluR2 in synaptic surface accumulation of the AMPA receptor.
10688364 2000 A phylogenetic analysis reveals an unusual sequence conservation within introns involved in RNA editing.
10501226 1999 Phosphorylation of serine-880 in GluR2 by protein kinase C prevents its C terminus from binding with glutamate receptor-interacting protein.
9648857 1998 AMPA receptor-mediated excitotoxicity in human NT2-N neurons results from loss of intracellular Ca2+ homeostasis following marked elevation of intracellular Na+.
9481670 1998 Adjacent asparagines in the NR2-subunit of the NMDA receptor channel control the voltage-dependent block by extracellular Mg2+.
8420792 1993 Expression of alternatively-spliced glutamate receptors in human hippocampus.
8269514 1993 RNA editing of AMPA receptor subunit GluR-B: a base-paired intron-exon structure determines position and efficiency.
8003671 1994 Primary structure and functional expression of the AMPA/kainate receptor subunit 2 from human brain.
7919190 1994 AMPA glutamate receptors and their flip and flop mRNAs in human hippocampus.
7545935 1994 The organization of the gene for the functionally dominant alpha-amino-3-hydroxy-5-methylisoxazole-4-propionic acid receptor subunit GluR-B.
7523595 1994 RNA editing of the glutamate receptor subunits GluR2 and GluR6 in human brain tissue.
1717158 1991 RNA editing in brain controls a determinant of ion flow in glutamate-gated channels.
1699275 1990 Flip and flop: a cell-specific functional switch in glutamate-operated channels of the CNS.
1319477 1992 Chromosomal localization of human glutamate receptor genes.
1311100 1992 Molecular cloning, chromosomal mapping, and functional expression of human brain glutamate receptors.