Property Summary

Ligand Count 76
NCBI Gene PubMed Count 105
PubMed Score 1441.52
PubTator Score 446.75

Knowledge Summary

Patent (10,090)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Heart disease 306 0.0 3.0

Expression

  Differential Expression (13)

Disease log2 FC p
lung cancer -1.800 1.4e-02
adult high grade glioma -1.900 5.7e-03
atypical teratoid / rhabdoid tumor -3.000 1.3e-03
ependymoma -1.200 8.6e-03
glioblastoma -1.600 5.3e-03
group 4 medulloblastoma -2.700 2.0e-05
lung adenocarcinoma -2.000 1.7e-17
lung carcinoma -2.300 8.3e-14
medulloblastoma, large-cell -2.700 7.5e-05
non-small cell lung cancer -1.667 9.2e-21
oligodendroglioma 1.700 1.5e-03
Pick disease -1.100 1.1e-02
primitive neuroectodermal tumor -1.200 3.0e-02

Gene RIF (61)

AA Sequence

MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEM      1 - 70
TYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQDALISIIDHY     71 - 140
KWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLN    141 - 210
AILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTR    211 - 280
VDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLT    281 - 350
GNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV    351 - 420
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAV    421 - 490
APLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRF    491 - 560
SPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSY    561 - 630
TANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTT    631 - 700
EEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQ    701 - 770
GLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK    771 - 840
GFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGATGL        841 - 906
//

Text Mined References (109)

PMID Year Title