Property Summary

NCBI Gene PubMed Count 18
PubMed Score 28.88
PubTator Score 18.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
pancreatic cancer 1.600 7.4e-05
cystic fibrosis -1.393 6.0e-05
medulloblastoma, large-cell -1.600 2.0e-04
pancreatic ductal adenocarcinoma liver m... -1.090 2.1e-02
non-small cell lung cancer 2.240 1.5e-11
intraductal papillary-mucinous neoplasm ... 3.100 5.6e-03
active ulcerative colitis 2.551 4.6e-02
interstitial cystitis -3.000 1.1e-04
adult high grade glioma -1.200 6.8e-04
pilocytic astrocytoma -1.200 3.4e-03
posterior fossa group A ependymoma -1.200 1.7e-05
sonic hedgehog group medulloblastoma -1.300 2.0e-04
pancreatic carcinoma 1.300 3.1e-02
nasopharyngeal carcinoma -1.400 3.2e-02
psoriasis 1.100 7.4e-04
spina bifida -2.294 3.6e-02
Breast cancer -1.200 1.2e-06
ovarian cancer 1.200 1.7e-02

Gene RIF (7)

PMID Text
26069269 GRHL1, GRHL2, and GRHL3 have roles in cellular proliferation, differentiation, adhesion, and polarity and may promote cancer or be tumor suppressors [review]
25896282 Grhl1 deficiency affects inner ear development in zebrafish.
25406394 Downregulation of miR122 by grainyhead-like 2 restricts the hepatocytic differentiation potential of adult liver progenitor cells.
24419085 A significant role for HDAC3 in the MYCN-mediated repression of GRHL1.
24375798 Our findings reveal important pathophysiological differences between human pulmonary fibrosis and specific mouse models of fibrosis and support a crucial role of GRHL2 in epithelial activation in lung fibrosis and perhaps also in epithelial plasticity.
18004979 LBP-1b and LBP-9 both stimulate LBP-32/MGR promoter activity.
12393799 Includes a comparison to TFCP2L2, the GRHL1 protein.

AA Sequence

MTQEYDNKRPVLVLQNEALYPQRRSYTSEDEAWKSFLENPLTAATKAMMSINGDEDSAAALGLLYDYYKV      1 - 70
PRERRSSTAKPEVEHPEPDHSKRNSIPIVTEQPLISAGENRVQVLKNVPFNIVLPHGNQLGIDKRGHLTA     71 - 140
PDTTVTVSIATMPTHSIKTETQPHGFAVGIPPAVYHPEPTERVVVFDRNLNTDQFSSGAQAPNAQRRTPD    141 - 210
STFSETFKEGVQEVFFPSDLSLRMPGMNSEDYVFDSVSGNNFEYTLEASKSLRQKPGDSTMTYLNKGQFY    211 - 280
PITLKEVSSSEGIHHPISKVRSVIMVVFAEDKSREDQLRHWKYWHSRQHTAKQRCIDIADYKESFNTISN    281 - 350
IEEIAYNAISFTWDINDEAKVFISVNCLSTDFSSQKGVKGLPLNIQVDTYSYNNRSNKPVHRAYCQIKVF    351 - 420
CDKGAERKIRDEERKQSKRKVSDVKVPLLPSHKRMDITVFKPFIDLDTQPVLFIPDVHFANLQRGTHVLP    421 - 490
IASEELEGEGSVLKRGPYGTEDDFAVPPSTKLARIEEPKRVLLYVRKESEEVFDALMLKTPSLKGLMEAI    491 - 560
SDKYDVPHDKIGKIFKKCKKGILVNMDDNIVKHYSNEDTFQLQIEEAGGSYKLTLTEI                561 - 618
//

Text Mined References (20)

PMID Year Title
26069269 2015 Recent discoveries concerning the involvement of transcription factors from the Grainyhead-like family in cancer.
25896282 2015 Grhl1 deficiency affects inner ear development in zebrafish.
25406394 2014 Downregulation of miR122 by grainyhead-like 2 restricts the hepatocytic differentiation potential of adult liver progenitor cells.
24419085 2014 GRHL1 acts as tumor suppressor in neuroblastoma and is negatively regulated by MYCN and HDAC3.
24375798 2014 Grainyhead-like 2 (GRHL2) distribution reveals novel pathophysiological differences between human idiopathic pulmonary fibrosis and mouse models of pulmonary fibrosis.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21081122 2011 The unique and cooperative roles of the Grainy head-like transcription factors in epidermal development reflect unexpected target gene specificity.
18288204 2008 Perturbed desmosomal cadherin expression in grainy head-like 1-null mice.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18004979 2008 LBP-1b, LBP-9, and LBP-32/MGR detected in syncytiotrophoblasts from first-trimester human placental tissue and their transcriptional regulation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12549979 2003 The identification and characterization of human Sister-of-Mammalian Grainyhead (SOM) expands the grainyhead-like family of developmental transcription factors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393799 2002 Mutation of a transcription factor, TFCP2L3, causes progressive autosomal dominant hearing loss, DFNA28.
12175488 2002 A highly conserved novel family of mammalian developmental transcription factors related to Drosophila grainyhead.
10644752 2000 Cloning of factors related to HIV-inducible LBP proteins that regulate steroidogenic factor-1-independent human placental transcription of the cholesterol side-chain cleavage enzyme, P450scc.