Property Summary

NCBI Gene PubMed Count 24
PubMed Score 26.13
PubTator Score 27.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 4.100 7.1e-07
glioblastoma -1.100 3.7e-02
intraductal papillary-mucinous adenoma (... -1.100 2.3e-03
intraductal papillary-mucinous neoplasm ... -1.100 2.3e-02
lung cancer 2.900 6.4e-06
breast carcinoma 1.400 1.4e-03
pilocytic astrocytoma -1.300 3.1e-03
lung carcinoma 2.300 5.1e-14
ovarian cancer -2.600 1.7e-03
pituitary cancer -1.100 2.6e-02
psoriasis -1.100 3.6e-29

Gene RIF (17)

PMID Text
25788566 the GREB1 region on chromosome 2p25.1 and the GREB1 gene may play a role in endometriosis risk
24998469 GREB1 is a critical mediator of both the estrogen-stimulated proliferation of breast cancer cells and the androgen-stimulated proliferation of prostate cancer cells
24469735 The expression of Greb1 was up-regulated in mouse tumors treated with E2 and was overexpressed in human ovarian cancers relative to human ovarian surface epithelium, suggesting a role for GREB1 in human ovarian tumor progression.
23876972 RAD54B and GREB1 gene polymorphisms may not be associated with PCOS in the Han Chinese population.
23403292 GREB1 is one of the central estrogen-specific ER cofactors, where it functions to mediate interactions between the ER and additional proteins.
22884659 GREB1 alpha mRNA/protein expression levels were increased in ectopic tissue in peritoneal endometriosis.
22359603 in ER-positive breast cancer cells, LRH-1 promotes cell proliferation by enhancing ERalpha mediated transcription of target genes such as GREB-1
21577013 Longer survival was associated with hypomethylation at specific CpG sites (e.g. GREB1, TGIF and TOB1) and hypermethylation in other genes (e.g. TMCO5, PTPRN and GUCY2C).
19945309 Tissue expression of GREB1 is associated with organ-confined prostate cancer and may constitute a gene associated with a favorable prognosis.
19842031 Characterize a monoclonal antibody that recognizes GREB1 protein in breast cancer cells.
19240061 Observational study of gene-disease association. (HuGE Navigator)
18794456 GREB1 is expressed in human skin, and is dose-dependently induced by topical 17-beta-estradiol treatment
17666587 estrogen-stimulated GREB1 transcription may involve coordinated ER binding to all three distal consensus ERE motifs
17463000 Data show that the induction of the gene regulated in breast cancer 1 (GREB1) is mediated by binding of estrogen receptor alpha to three consensus estrogen response elements spread over approximately 20 kb of upstream flanking sequences.
16496412 GREB1 is expressed in proliferating prostatic tissue and prostate cancer, is regulated by androgens, and suppression of GREB1 blocks androgen-induced growth suggesting GREB1 may be critically involved in prostate cancer proliferation.
15986123 GREB1 is critically involved in the estrogen induced growth of breast cancer cells.
15001666 Estrogen receptors are recruited at several proximal and distal estrogen response elements upstream of the GREB1 transcription unit.

AA Sequence

MGNSYAGQLKTTRFEEVLHNSIEASLRSNNLVPRPIFSQLYLEAEQQLAALEGGSRVDNEEEEEEGEGGL      1 - 70
ETNGPPNPFQLHPLPEGCCTTDGFCQAGKDLRLVSISNEPMDVPAGFLLVGVKSPSLPDHLLVCAVDKRF     71 - 140
LPDDNGHNALLGFSGNCVGCGKKGFCYFTEFSNHINLKLTTQPKKQKHLKYYLVRNAQGTLTKGPLICWK    141 - 210
GSEFRSRQIPASTCSSSLFPALESTAAFPSEPVPGTNPSILMGAQQAGPASDHPSLNAAMGPAVFNGKDS    211 - 280
PKCQQLAKNNLLALPRPSALGILSNSGPPKKRHKGWSPESPSAPDGGCPQGGGNRAKYESAGMSCVPQVG    281 - 350
LVGPASVTFPVVASGEPVSVPDNLLKICKAKPVIFKGHGNFPYLCGNLNDVVVSPLLYTCYQNSQSVSRA    351 - 420
YEQYGASAIQPISEEMQLLLTVYYLVQLAADQVPLMEDLEQIFLRSWRESHLTEIRQYQQAPPQPFPPAP    421 - 490
SAAAPVTSAQLPWLASLAASSCNDSVHVIECAYSLAEGLSEMFRLLVEGKLAKTNYVVIICACRSAAIDS    491 - 560
CIAVTGKYQARILSESLLTPAEYQKEVNYELVTGKVDSLGAFFSTLCPEGDIDILLDKFHQENQGHISSS    561 - 630
LAASSVTKAASLDVSGTPVCTSYNLEPHSIRPFQLAVAQKLLSHVCSIADSSTQNLDLGSFEKVDFLICI    631 - 700
PPSEVTYQQTLLHVWHSGVLLELGLKKEHMTKQRVEQYVLKLDTEAQTKFKAFLQNSFQNPHTLFVLIHD    701 - 770
HAHWDLVSSTVHNLYSQSDPSVGLVDRLLNCREVKEAPNIVTLHVTSFPYALQTQHTLISPYNEIHWPAS    771 - 840
CSNGVDLYHENKKYFGLSEFIESTLSGHSLPLLRYDSSFEAMVTALGKRFPRLHSAVIRTFVLVQHYAAA    841 - 910
LMAVSGLPQMKNYTSVETLEITQNLLNSPKQCPCGHGLMVLLRVPCSPLAVVAYERLAHVRARLALEEHF    911 - 980
EIILGSPSSGVTVGKHFVKQLRMWQKIEDVEWRPQTYLELEGLPCILIFSGMDPHGESLPRSLRYCDLRL    981 - 1050
INSSCLVRTALEQELGLAAYFVSNEVPLEKGARNEALESDAEKLSSTDNEDEELGTEGSTSEKRSPMKRE   1051 - 1120
RSRSHDSASSSLSSKASGSALGGESSAQPTALPQGEHARSPQPRGPAEEGRAPGEKQRPRASQGPPSAIS   1121 - 1190
RHSPGPTPQPDCSLRTGQRSVQVSVTSSCSQLSSSSGSSSSSVAPAAGTWVLQASQCSLTKACRQPPIVF   1191 - 1260
LPKLVYDMVVSTDSSGLPKAASLLPSPSVMWASSFRPLLSKTMTSTEQSLYYRQWTVPRPSHMDYGNRAE   1261 - 1330
GRVDGFHPRRLLLSGPPQIGKTGAYLQFLSVLSRMLVRLTEVDVYDEEEININLREESDWHYLQLSDPWP   1331 - 1400
DLELFKKLPFDYIIHDPKYEDASLICSHYQGIKSEDRGMSRKPEDLYVRRQTARMRLSKYAAYNTYHHCE   1401 - 1470
QCHQYMGFHPRYQLYESTLHAFAFSYSMLGEEIQLHFIIPKSKEHHFVFSQPGGQLESMRLPLVTDKSHE   1471 - 1540
YIKSPTFTPTTGRHEHGLFNLYHAMDGASHLHVLVVKEYEMAIYKKYWPNHIMLVLPSIFNSAGVGAAHF   1541 - 1610
LIKELSYHNLELERNRQEELGIKPQDIWPFIVISDDSCVMWNVVDVNSAGERSREFSWSERNVSLKHIMQ   1611 - 1680
HIEAAPDIMHYALLGLRKWSSKTRASEVQEPFSRCHVHNFIILNVDLTQNVQYNQNRFLCDDVDFNLRVH   1681 - 1750
SAGLLLCRFNRFSVMKKQIVVGGHRSFHITSKVSDNSAAVVPAQYICAPDSKHTFLAAPAQLLLEKFLQH   1751 - 1820
HSHLFFPLSLKNHDHPVLSVDCYLNLGSQISVCYVSSRPHSLNISCSDLLFSGLLLYLCDSFVGASFLKK   1821 - 1890
FHFLKGATLCVICQDRSSLRQTVVRLELEDEWQFRLRDEFQTANAREDRPLFFLTGRHI              1891 - 1949
//

Text Mined References (27)

PMID Year Title
25788566 2015 Functional evaluation of genetic variants associated with endometriosis near GREB1.
24998469 2014 Consideration of GREB1 as a potential therapeutic target for hormone-responsive or endocrine-resistant cancers.
24469735 2014 17?-estradiol upregulates GREB1 and accelerates ovarian tumor progression in vivo.
23876972 2013 Replication study of RAD54B and GREB1 polymorphisms and risk of PCOS in Han Chinese.
23403292 2013 Endogenous purification reveals GREB1 as a key estrogen receptor regulatory factor.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23104006 2012 Genome-wide association meta-analysis identifies new endometriosis risk loci.
22884659 2012 The expression of estrogen receptors as well as GREB1, c-MYC, and cyclin D1, estrogen-regulated genes implicated in proliferation, is increased in peritoneal endometriosis.
22359603 2012 The orphan nuclear receptor LRH-1 and ER? activate GREB1 expression to induce breast cancer cell proliferation.
21577013 2011 Progression-free survival in ovarian cancer is reflected in epigenetic DNA methylation profiles.
19945309 GREB1 tissue expression is associated with organ-confined prostate cancer.
19842031 2010 Correlation of GREB1 mRNA with protein expression in breast cancer: validation of a novel GREB1 monoclonal antibody.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18794456 2008 Induction of collagen by estradiol: difference between sun-protected and photodamaged human skin in vivo.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
17666587 2007 Long-range activation of GREB1 by estrogen receptor via three distal consensus estrogen-responsive elements in breast cancer cells.
17463000 2007 Regulation of GREB1 transcription by estrogen receptor alpha through a multipartite enhancer spread over 20 kb of upstream flanking sequences.
16496412 2006 GREB1 is a novel androgen-regulated gene required for prostate cancer growth.
15986123 2005 GREB 1 is a critical regulator of hormone dependent breast cancer growth.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345050 2004 Discovery of estrogen receptor alpha target genes and response elements in breast tumor cells.
15001666 2004 Genome-wide identification of high-affinity estrogen response elements in human and mouse.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11103799 2000 PDZK1 and GREB1 are estrogen-regulated genes expressed in hormone-responsive breast cancer.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.