Property Summary

NCBI Gene PubMed Count 69
PubMed Score 127.69
PubTator Score 94.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.100 2.1e-03
osteosarcoma 2.221 5.5e-09
interstitial cystitis -1.400 1.5e-04
ductal carcinoma in situ 2.100 4.0e-02
invasive ductal carcinoma 2.400 4.6e-02

Gene RIF (37)

PMID Text
26617853 Suggest close relationship between Grb7 gene amplification and GRB7 protein overexpression in human ovarian cancer. Immunohistochemistry might have limited diagnostic value in these tumors compared to fluorescence in situ hybridization.
25182704 Grb7 was found to be significantly related to the biological classification of breast cancer
24637751 apo Grb7 SH2 domain crystallized in the trigonal space group P63, whereas the G7-B1-Grb7 SH2 domain complex crystallized in the monoclinic space group P21
24464577 The data reveal that Grb7 plays an important role in breast cancer progression, beyond the context of HER2+ve cell types
24089360 Grb7 protein interacts with Filamin-a, an actin-crosslinking component of the cell cytoskeleton.
23743201 Data suggest that calmodulin controls Grb7-mediated cell migration.
22811067 Data propose the phosphorylation state of Grb7-SH2 domain tyrosine residues could control Grb7 dimerization, and dimerization may be an important regulatory step in Grb7 binding to RTKs such as erbB2.
22673522 propose that CaM inhibits the translocation of Grb7 to the nucleus after binding to its CaM-BD and therefore occluding its overlapping NLS
22584052 GRB7 is a context-dependent oncogene, which modulates the ERBB2 signaling pathway through enhanced phosphorylation of ERBB2 and Akt.
22253820 A series of Grb7 SH2 domain-binding nonphosphorylated peptides in the yeast two-hybrid system, were identified.
21139214 X-ray diffraction data were collected from crystals to 2.4A resolution for G7-18NATE in complex with its Grb7 SH2 domain.
20665473 Full-length Grb7 and Hax-1 interact in mammalian cells and Grb7 is tyrosine phosphorylated.
20635137 GRB7 protein over-expression is an independent adverse prognostic factor in human breast cancer
20622016 Findings illustrate an underlying mechanism by which Grb7 promotes tumorigenesis through the formation of a novel EGFR-Grb7-Ras signaling complex, thereby highlighting the potential strategy of targeting Grb7 as an anti-breast cancer therapy.
20388850 Studies implicate that the overexpressed GRB7 and GRB7v are associated with high-grade tumors and exert distinct tumorigenic functions through regulating different signaling pathways in ovarian cancer cells.
20370637 proposed helix-swapping of the SH2 domain of Grb7, a regulatory protein implicated in cancer progression and inflammation
20126311 Data show that Grb7 removal by RNA-interference reduces breast cancer cell viability.
19717535 High Grb7 is associated with breast cancer.
19648926 Results illuminate the membrane-recruitment mechanisms of Grb7, Grb10 and Grb14.
19473962 Formation of focal adhesion kinase *Grb7 complexes and Grb7 phosphorylation by FAK in an integrin-dependent manner were essential for cell migration, proliferation and anchorage-independent growth in A431 epidermal carcinoma cells.
19124506 Observational study of gene-disease association. (HuGE Navigator)
17916906 GRB-7 over-expression plays pivotal roles in activating signal transduction and promoting tumor growth in breast cancer cells with chromosome 17q11-21 amplification
17705331 The solution structure and the backbone relaxation behavior of the Grb7-SH2/erbB2 peptide complex.
17634422 Grb7 plays an important role in hepatocellular carcinoma progression and is strongly associated with expression of focal adhesion kinase.
17426702 The Grb7 peptide has potential to be developed as a therapeutic agent alone, or in combination with traditional chemotherapy.
17117180 Observational study of gene-disease association. (HuGE Navigator)
16595785 Grb7 expression was statistically significantly different between specimens from patients with or without lymph node metastasis.
16354586 Mutation and elevated expression of GRB7 is associated with the development of testicular germ cell tumors
15841400 Grb7-SH2 domain dimerisation depends on a single point mutation
15806159 Human Grb7 specifically binds CaM in a calcium2+-dependent manner; possible alterations of the Grb7/CaM system in tumor cells could be relevant to high motility seen in many cancer cells
15470489 Incresaed Grb7 expression is associated with disease progression in chronic lymphocytic leukemia
15010812 Oncogenomic recombination hotspot around the PPP1R1B-STARD3-TCAP-PNMT-PERLD1-ERBB2-C17orf37-GRB7 amplicon at human chromosome 17q12 is closely linked to evolutionary recombination hotspot around the GSDML-GSDM locus.
14585167 review of GRB7 binding sites and molecular interactions, and role in progression and invasive potential in cancer, making it a target for therapeutics
12061724 NMR assignments of backbone 1H, 13C, and 15N resonances of Grb7-SH2 domain in complex with a phosphorylated peptide ligand
12021278 the PH domain mediated Grb7 binding to phospholipids
11897833 Investigation of the GRB2, GRB7, and CSH1 genes as candidates for the Silver-Russell syndrome (SRS) on chromosome 17q.
11809769 Identification of novel non-phosphorylated ligands, which bind selectively to the SH2 domain of Grb7

AA Sequence

MELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERRATSLPSIPNP      1 - 70
FPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSD     71 - 140
ETWGLVECHPHLALERGLEDHESVVEVQAAWPVGGDSRFVFRKNFAKYELFKSSPHSLFPEKMVSSCLDA    141 - 210
HTGISHEDLIQNFLNAGSFPEIQGFLQLRGSGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNE    211 - 280
SNVYVVTQGRKLYGMPTDFGFCVKPNKLRNGHKGLRIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQQAQ    281 - 350
SRHLHPSCLGSPPLRSASDNTLVAMDFSGHAGRVIENPREALSVALEEAQAWRKKTNHRLSLPMPASGTS    351 - 420
LSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGR    421 - 490
LYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL                                491 - 532
//

Text Mined References (75)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26617853 2015 Grb7 gene amplification and protein expression by FISH and IHC in ovarian cancer.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25416956 2014 A proteome-scale map of the human interactome network.
25182704 2014 Validation of analytical breast cancer microarray analysis in medical laboratory.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24637751 2014 Preparation of crystals for characterizing the Grb7 SH2 domain before and after complex formation with a bicyclic peptide antagonist.
24464577 2014 Context-dependent role of Grb7 in HER2+ve and triple-negative breast cancer cell lines.
24189400 2013 Perturbation of the mutated EGFR interactome identifies vulnerabilities and resistance mechanisms.
24089360 2013 Grb7 and Filamin-a associate and are colocalized to cell membrane ruffles upon EGF stimulation.
23743201 2013 Deletion of the calmodulin-binding domain of Grb7 impairs cell attachment to the extracellular matrix and migration.
22811067 2012 Dimerization in the Grb7 protein.
22673522 2012 Calmodulin regulates the translocation of Grb7 into the nucleus.
22584052 2012 Expression screening of 17q12-21 amplicon reveals GRB7 as an ERBB2-dependent oncogene.
22253820 2012 Novel nonphosphorylated peptides with conserved sequences selectively bind to Grb7 SH2 domain with affinity comparable to its phosphorylated ligand.
21139214 2010 Preparation and crystallization of the Grb7 SH2 domain in complex with the G7-18NATE nonphosphorylated cyclic inhibitor peptide.
20665473 Grb7 binds to Hax-1 and undergoes an intramolecular domain association that offers a model for Grb7 regulation.
20635137 2011 GRB7 protein over-expression and clinical outcome in breast cancer.
20622016 2010 EGF-induced Grb7 recruits and promotes Ras activity essential for the tumorigenicity of Sk-Br3 breast cancer cells.
20388850 2010 Differential functions of growth factor receptor-bound protein 7 (GRB7) and its variant GRB7v in ovarian carcinogenesis.
20370637 2010 The intertwining of structure and function: proposed helix-swapping of the SH2 domain of Grb7, a regulatory protein implicated in cancer progression and inflammation.
20126311 2010 Grb7 upregulation is a molecular adaptation to HER2 signaling inhibition due to removal of Akt-mediated gene repression.
19717535 2010 Growth factor receptor-bound protein-7 (Grb7) as a prognostic marker and therapeutic target in breast cancer.
19648926 2009 Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14.
19473962 2009 Tyrosine phosphorylation of growth factor receptor-bound protein-7 by focal adhesion kinase in the regulation of cell migration, proliferation, and tumorigenesis.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18853468 The cell migration protein Grb7 associates with transcriptional regulator FHL2 in a Grb7 phosphorylation-dependent manner.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17916906 2008 GRB-7 facilitates HER-2/Neu-mediated signal transduction and tumor formation.
17894853 2007 Grb7 SH2 domain structure and interactions with a cyclic peptide inhibitor of cancer cell migration and proliferation.
17705331 Calorimetric investigation of phosphorylated and non-phosphorylated peptide ligand binding to the human Grb7-SH2 domain.
17634422 2007 Role of growth factor receptor bound protein 7 in hepatocellular carcinoma.
17426702 2007 Combination treatment with Grb7 peptide and Doxorubicin or Trastuzumab (Herceptin) results in cooperative cell growth inhibition in breast cancer cells.
17117180 2006 HapMap-based study of the 17q21 ERBB2 amplicon in susceptibility to breast cancer.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16595785 2006 Specific peptide ligand for Grb7 signal transduction protein and pancreatic cancer metastasis.
16354586 2005 Activating mutations and/or expression levels of tyrosine kinase receptors GRB7, RAS, and BRAF in testicular germ cell tumors.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
16129412 2005 Signaling by Kit protein-tyrosine kinase--the stem cell factor receptor.
15930003 2005 Backbone nuclear relaxation characteristics and calorimetric investigation of the human Grb7-SH2/erbB2 peptide complex.
15841400 2005 Grb7-SH2 domain dimerisation is affected by a single point mutation.
15806159 2005 The adaptor Grb7 is a novel calmodulin-binding protein: functional implications of the interaction of calmodulin with Grb7.
15526160 2004 Signal transduction via the stem cell factor receptor/c-Kit.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15470489 2004 Grb7 expression and cellular migration in chronic lymphocytic leukemia: a comparative study of early and advanced stage disease.
15010812 2004 Evolutionary recombination hotspot around GSDML-GSDM locus is closely linked to the oncogenomic recombination hotspot around the PPP1R1B-ERBB2-GRB7 amplicon.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14585167 2003 Grb7-based molecular therapeutics in cancer.
12975581 2003 Solution structure of the human Grb7-SH2 domain/erbB2 peptide complex and structural basis for Grb7 binding to ErbB2.
12853971 2003 NIK is a component of the EGF/heregulin receptor signaling complexes.
12852788 2003 Adaptor signalling proteins Grb2 and Grb7 are recruited by human G6f, a novel member of the immunoglobulin superfamily encoded in the MHC.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12223469 2002 EphB1 associates with Grb7 and regulates cell migration.
12061724 2002 Assignment of backbone 1H, 13C, and 15N resonances of human Grb7-SH2 domain in complex with a phosphorylated peptide ligand.
12021278 2002 Association of Grb7 with phosphoinositides and its role in the regulation of cell migration.
11897833 2002 Investigation of the GRB2, GRB7, and CSH1 genes as candidates for the Silver-Russell syndrome (SRS) on chromosome 17q.
11607834 2001 The Grb7 family proteins: structure, interactions with other signaling molecules and potential cellular functions.
11075810 2000 Constitutive and growth factor-regulated phosphorylation of caveolin-1 occurs at the same site (Tyr-14) in vivo: identification of a c-Src/Cav-1/Grb7 signaling cassette.
10893408 2000 Role of Grb7 targeting to focal contacts and its phosphorylation by focal adhesion kinase in regulation of cell migration.
10803466 2000 Evidence for an interaction between the insulin receptor and Grb7. A role for two of its binding domains, PIR and SH2.
10664463 2000 Interaction of the Grb7 adapter protein with Rnd1, a new member of the Rho family.
10521483 1999 Identification of Tek/Tie2 binding partners. Binding to a multifunctional docking site mediates cell survival and migration.
10446223 1999 Association of focal adhesion kinase with Grb7 and its role in cell migration.
10377264 1999 Identification of Tyr-703 and Tyr-936 as the primary association sites for Grb2 and Grb7 in the c-Kit/stem cell factor receptor.
9710451 1998 A novel variant of human Grb7 is associated with invasive esophageal carcinoma.
9516479 1998 Analysis of Grb7 recruitment by heregulin-activated erbB receptors reveals a novel target selectivity for erbB3.
9360986 1997 Cloning, chromosome localization, expression, and characterization of an Src homology 2 and pleckstrin homology domain-containing insulin receptor binding protein hGrb10gamma.
9125150 1997 Molecular cloning of human GRB-7 co-amplified with CAB1 and c-ERBB-2 in primary gastric cancer.
9079677 1997 Structural determinants of the interaction between the erbB2 receptor and the Src homology 2 domain of Grb7.
8988034 1997 Coexpression of Grb7 with epidermal growth factor receptor or Her2/erbB2 in human advanced esophageal carcinoma.
8940081 1996 Grb7 is a downstream signaling component of platelet-derived growth factor alpha- and beta-receptors.
8631863 1996 Direct association between the Ret receptor tyrosine kinase and the Src homology 2-containing adapter protein Grb7.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1409582 1992 High-efficiency expression/cloning of epidermal growth factor-receptor-binding proteins with Src homology 2 domains.