Property Summary

NCBI Gene PubMed Count 70
PubMed Score 134.48
PubTator Score 94.48

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
ductal carcinoma in situ 2.100 4.0e-02
interstitial cystitis -1.400 1.5e-04
invasive ductal carcinoma 2.400 4.6e-02
osteosarcoma 2.221 5.5e-09
psoriasis 1.100 2.1e-03

PDB (10)

Gene RIF (38)

AA Sequence

MELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERRATSLPSIPNP      1 - 70
FPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSD     71 - 140
ETWGLVECHPHLALERGLEDHESVVEVQAAWPVGGDSRFVFRKNFAKYELFKSSPHSLFPEKMVSSCLDA    141 - 210
HTGISHEDLIQNFLNAGSFPEIQGFLQLRGSGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNE    211 - 280
SNVYVVTQGRKLYGMPTDFGFCVKPNKLRNGHKGLRIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQQAQ    281 - 350
SRHLHPSCLGSPPLRSASDNTLVAMDFSGHAGRVIENPREALSVALEEAQAWRKKTNHRLSLPMPASGTS    351 - 420
LSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGR    421 - 490
LYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL                                491 - 532
//

Text Mined References (76)

PMID Year Title