Property Summary

NCBI Gene PubMed Count 517
PubMed Score 933.52
PubTator Score 685.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Cancer 2346 4.836 2.4

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis 1.300 1.7e-03
psoriasis 2.800 2.4e-05
osteosarcoma -1.429 1.7e-03
medulloblastoma, large-cell -1.100 3.6e-04
juvenile dermatomyositis 1.032 6.6e-12
invasive ductal carcinoma 1.400 1.5e-02
ovarian cancer 2.100 1.7e-05

Protein-protein Interaction (344)

IGKV2-28   IGKV2D-30   IGKV3D-20   IGKV1-12   IGLC7   WIPF3   MYO1C   HIP1   PIK3CD   WASL   PIK3C2A   GFRA2   PIK3R2   SH2B2   NRG2   FCHO1   IRS4   RASGRF2   HGS   PIP5K1B   SPTBN2   SYNJ2   INPPL1   GRIN2D   PDPK1   SYNJ1   TGOLN2   WIPF1   FRS3   LAT   SPRY2   TYROBP   PIP5K1C   PSPN   JAK2   DNAJC6   HIP1R   VAMP4   GRAP2   STAM2   PAK3   ERLIN2   EPN2   RASGRP1   ABL1   NRAS   HRAS   KRAS   PDGFB   LDLR   NGF   AVP   INS   IGF2   IL2RA   IGKV1D-33   IGKV1-33   IGKV1-39   IGKV1-17   IGKV1D-16   IGKV1-5   IGKV1D-12   IGKV2D-40   IGKV2D-28   IGKV3-20   IGKV3-15   IGLV1-44   IGLV1-47   IGLV1-51   IGLV1-40   IGLV2-14   IGLV2-23   IGLV2-11   IGLV2-8   IGLV3-19   IGLV3-1   IGLV3-25   IGLV3-27   IGLV6-57   IGHV1-69   IGHV1-46   IGHV3-11   IGHV3-48   IGHV3-23   IGHV3-13   IGHV3-53   IGHV3-30   IGHV3-33   IGHV3-7   IGHV3-9   IGHV2-70   IGHV2-5   IGHV4-39   IGHV4-59   IGKC   IGHM   SPTA1   TFRC   TF   PDGFA   IGLV7-43   VWF   IGKV1-16   IGKV1D-39   IGKV3-11   NTRK1   IGF1   ITGB3   IL5   PRKCB   INSR   LCK   IGKV2-30   IGKV4-1   IGKV5-2   IGHV4-34   NEFL   HSP90AA1   YES1   LYN   RET   IGF1R   ITGA2B   MET   IL3   CLTA   CLTB   PDGFRB   IGLC6   IGLC1   IGLC2   IGLC3   UBB   UBC   KIT   HSPA8   SPTB   FGFR1   IGF2R   SRC   NCAM1   HLA-E   HGF   IL2RB   BRAF   VAV1   PDGFRA   NCK1   PLCG2   PTPRA   PLCG1   RAB5A   M6PR   SYT1   KITLG   FGFR2   FGFR3   IGHV1-2   JAK1   PTPN3   KLRC2   KLRK1   IL3RA   MAPK3   PIK3R1   PTPN6   SHC1   AVPR2   AKT1   IRS1   WNT5A   PIK3CA   PIK3CB   TEC   WAS   SYK   CRK   PIP4K2A   PXN   ARRB1   AMPH   DNM2   VAMP7   JAK3   AGFG1   VAV2   CLTCL1   NCKAP1L   ARPC4   PTEN   IL2   CDC42   RAP1B   PPP2CB   RAP1A   RPS27A   UBA52   RAC1   VAMP2   PPP2CA   SIRPA   PIP4K2B   IGLV3-21   SHC2   DAB2   LRP2   CLTC   SPTBN1   IL5RA   OCRL   NRG1   TEK   PRKCQ   GRIN1   PTPN11   SOS1   ITK   FCHO2   GRIN2A   LCP2   PAK1   PAK2   CBLB   GRIN2B   MAP3K1   KLRD1   GAB1   PICALM   CAMK2B   CAMK2G   CAMK2D   SPTAN1   RAPGEF1   RASGRF1   SCARB2   CTTN   ITPR2   ITPR3   ITPR1   GRIN2C   GAPVD1   ERBB4   ITSN1   VAMP3   CDC37   SLC18A3   AAK1   LDLRAP1   FNBP1L   THEM4   ARTN   KIAA0319   TRAT1   PIK3AP1   CYFIP1   APBB1IP   BTLA   SYT9   KLB   RASGRP3   ABI1   RASGEF1A   SYT2   NECAP1   REPS2   PIP4K2C   RASGRP4   WIPF2   FRS2   BRK1   BLNK   NRG4   STON2   SHC3   STAM   INPP5D   TNFRSF14   SH3KBP1   REPS1   CYFIP2   FNBP1   TRIB3   RANBP9   HBEGF   NRTN   PIP5K1A   SH3GL2   SGIP1   VAMP8   LAT2   GFRA4   SPTBN4   MYO10   SPTBN5   PAG1   SLC2A8   TREM2   NCKIPSD   EPS15L1   KL   VAV3   MYH2   DAPP1   PACSIN2   BAIAP2   GAB2   CAMK2A   NCKAP1   TLN1   RAPGEF2   IRS2   SNX9   EPN1   WASF2   ICOS   ARAP1   CBL   DNM1   DNM3   SOS2   DOCK5   DOCK1   ASAP1   ASAP2   TNK2   PEAK1   ZMYM6   NKX2-5   CYLD   PIK3C2B   ELMO2   GAREM1   GAREM2   VPS37B   SNX18   PTPN23   STAMBP   DOCK4   ERRFI1   BCR   MVB12A   MAP4K5   SPATA2L   VPS28  

Gene RIF (121)

PMID Text
26511382 TGF-beta2 induces Grb2 to recruit PI3-K to TGF-RII that activates JNK/AP-1-signaling and augments invasiveness of Theileria-transformed macrophages.
26188370 Genetic variation near GRB2 on chromosome 17q25.1 is associated with sight-threatening diabetic retinopathy.
26103942 Only monomeric Grb2 is capable of upregulating MAP kinase signalling. The dimeric state is inhibitory to this process. The self-association/dissociation of Grb2 represents a switch that regulates MAP kinase activity and hence controls cancer progression.
26079855 findings show that regions outside of the consensus PxxPxR sites drive the high affinity association of GRB2 with SH3 domain ligands
25688510 In addition, GRB2 and UBC were found to be hub nodes in the differentially expressed subnetwork and may be used as potential biomarkers or targets for the diagnosis of bladder cancer.
25659534 down-regulated molecule growth factor receptor-bound protein 2 (GRB2) was a prominent node in fourteen cell proliferation-related sub-pathways.
25413232 The immunoglobulin tail tyrosine motif in the cytoplasmic segments of membrane-bound IgGs acts as the principle signal amplifier by incorporating a Grb2-Btk signaling.
25041730 C-SH3 of Grb2 mediates the interaction with mutant Htt and this interaction being stronger could replace Gab1, with mutant Htt becoming the preferred partner. This would have immense effect on downstream signaling events.
25031732 GRB2 was an independent factor in prognosis of esophageal squamous cell carcinoma patients
24939894 Knockdown of GRB2 suppressed LMTK3-induced CDC42 activation, blocked ITGA5 and ITGB1 expression promoted by the transcription factor serum response factor (SRF), and reduced invasive activity
24882360 The N-terminal SH3 domain of Grb2 specifically interacts with UVRAG, unlike the C-terminal SH3 domain. This interaction helps to understand the role of Grb2 in the autophagic maturation of vesicles.
24708867 these results identify Grb2 and Shc as central signaling effectors of Met-driven progression of intestinal epithelial-derived cancers. Notably, they suggest that Grb2 may represent a promising target for the design of novel colorectal cancer therapies.
24697349 Recruitment of the adaptor protein Grb2 to EGFR tetramers.
24440983 Metastatic outcome can be dictated by the constitutive competition between Grb2 and Plcgamma1 for the phosphorylation-independent binding site on FGFR2.
24407288 a central role for adaptor proteins p66Shc and Grb2 in the regulation of ARF1 and ARF6 activation in invasive breast cancer cells.
24399467 SGEF interacts with Grb2.
24391994 The combined GRB2 and GAB1 protein expression was significantly associated with aggressive tumor progression and poor prognosis in patients with hepatocellular carcinoma.
24259669 Trafficking of EGFR and Grb2 in living HeLa cells stimulated with low, physiological concentrations of EGFR ligands, was analyzed..
24100123 In neuronal cells, amyloid-beta protein precursor intracellular domain co-localizes with GRB2 in cell compartments.
23946459 VP11/12 SFK-binding motifs recruit Lck and the activated Src family kinase then leads (directly or indirectly) to phosphorylation of additional motifs involved in recruiting p85, Grb2, and Shc.
23922722 Epigenetic repression of miR-376c accelerated EGF-dependent cell migration through its target GRB2 in HuCCT1 cells.
23916875 A deficient lipid rafts recruitment of CD3zeta/ZAP-70/Grb2, and these proteins do not merge with GM1 within the lipid rafts.
23771793 suppression of Grb2 expression in HepG2 cells improved hepatic steatosis, glucose metabolism, oxidative stress, and apoptosis induced by palmitic acid incubation partly though modulating the insulin signaling pathway.
23762317 Grb3-3, an isoform of Grb2, is upregulated by HIV-1 Nef protein and potentiates HIV-1 LTR promoter activity
23700486 EGFR interacts with Grb2 in both constitutive and EGF-dependent manners, whereas the HER3-Grb2 interaction requires the heteromerization of EGFR and HER3.
23460737 GRB2-mediated recruitment of THEMIS to LAT is essential for thymocyte development.
23420874 Grb2 exerts constitutive control over the mutually dependent activities of FGFR2 and Shp2.
23334917 Although Sos1 and Gab1 recognize two non-overlapping sites within the Grb2 adaptor, allostery promotes the formation of two distinct pools of Grb2-Sos1 and Grb2-Gab1 binary signaling complexes in lieu of a composite Sos1-Grb2-Gab1 ternary complex.
23227982 Grb3-3, an isoform of Grb2, is upregulated by HIV-1 Nef protein and potentiates HIV-1 LTR promoter activity
23223229 The Dok-3/Grb2 protein signal module attenuates Lyn kinase-dependent activation of Syk kinase in B cell antigen receptor microclusters
23159538 The results fit with a role of Grb2 in protein aggregation, achieving specificity by multivalent interactions, despite the relatively low affinity of single SH3 interactions.
23154388 the N-terminal SH3-SH2 region of grb2 protein was in charge of binding with phosphorylated TIGIT.
23131845 The discovery of a negative regulatory role for Grb2 reveals that this adaptor acts as a double-edged sword in the regulation of RTK signaling.
22882974 Grb2 interacts with ADAM12 and is required for ADAM12 internalization.
22726438 Study describes a mechanism whereby Grb2 exerts control of FGFR2 kinase activity prior to growth factor binding.
22536782 Data show that bivalent binding drives the formation of the Grb2-Gab1 signaling complex in a noncooperative manner.
22505611 Grb2 is thereby recruited into the plexin-B1 receptor complex and, through its SH3 domain, interacts with p190 RhoGAP and mediates RhoA deactivation.
22396725 Modeling and simulation of aggregation of membrane protein LAT with molecular variability in the number of binding sites for cytosolic Grb2-SOS1-Grb2
22360309 multiple binding sites within Sos1 provide a physical route for Grb2 to hop in a flip-flop manner from one site to the next through facilitated diffusion, and such rapid exchange forms the basis of cooperativity driving bivalent binding of Grb2 to Sos1
22344067 T-cell antigen receptor (TCR)-mediated Erk activation requires RasGRP1, but not Grb2/Sos.
22327338 the negative loop on p38 is mediated by c-ABL phosphorylation at tyrosine 105 of the adaptor protein NCK1, while the phosphorylation at tyrosine 209 of GRB2 down-modulates ERK1/2 and JNKs signaling.
22190034 Grb3-3, an isoform of Grb2, is upregulated by HIV-1 Nef protein and potentiates HIV-1 LTR promoter activity
22094095 Hypoxia can induce the activation of cytoplasmic FAK, Grb2 and paxillin so as to regulate the migration, survival and proliferation of pulmonary artery smooth cells.
22027826 ACAP4 protein cooperates with Grb2 protein to orchestrate epidermal growth factor-stimulated integrin beta1 recycling in cell migration
22001015 High-resolution crystal structures of Grb2-SH2 domain bound to AICD peptides reveal a unique mode of binding where the peptides assume a noncanonical conformation that is unlike other structures of AICD peptides bound to protein-tyrosine-binding domains
21745501 The Tat/Grb2 interaction affects also viral function by inhibiting the Tat-mediated transactivation of HIV-1 LTR and viral replication in infected primary microglia.
21745501 Grb3-3, an isoform of Grb2, is upregulated by HIV-1 Nef protein and potentiates HIV-1 LTR promoter activity
21706016 Our data reliably define context-specific and time-dependent networks that form around GRB2 after stimulation, and reveal core and growth factor-selective complexes comprising 90 proteins identified as interacting with GRB2 in HEK293T cells.
21508312 RhoU physically associates with activated EGFR in a GRB2-dependent manner; suppression of GRB2 by RNA interference abrogates the interaction of RhoU with activated EGFR.
21195589 To our knowledge, this is the first report of GRB2 being significantly associated with schizophrenia in a specific population.
21185312 In addition to two signaling-associated proteins (GIT1 and AF6), the heterogeneous nuclear ribonucleoproteins F, H1, and H2 were thus identified as novel direct binders to GRB2.
21179510 Histidine domain-protein tyrosine phosphatase interacts with Grb2 and GrpL
21072043 Grb2 knockdown significantly inhibits proliferation and survival of BCR-ABL-expressing CD34+ cells, but not control CD34+ cells
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20850195 Grb2 specifically localizes to degradative structures formed in Src-transformed fibroblasts and PMA-stimulated endothelial cells, but not invadopodia or podosomes formed in macrophages.
20700730 Apolipoprotein E, growth factor receptor-bound protein 2, Golgi SNAP receptor complex member 1, and glucosidase, beta, acid may play a neurodegenerative role in stress urinary incontinence development.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20618341 intracellular Francisella tularensis novicida triggers temporal and early activation of Ras through the SOS2/GrB2/PKCalpha/PKCbetaI quaternary complex; Ras signalling by intracellular F. tularensis is essential for intracellular proliferation in the cytosol
20596655 The SH2 domain of Grb2 has the potential to be used as a binding component of a probe to detect activated-RTK (receptor tyrosine kinases) and to evaluate the effect of kinase inhibitors on RTK activation.
20554525 Grb2 regulates primarily the NPM-ALK-mediated phosphorylation of SHP2 and plays a key role in ALCL cell growth.
20468064 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20124721 crystals of Grb2 SH2 domain-FAK belonged to space group P3(1)21, with unit-cell parameters a = b = 102.7, c = 127.6 A, alpha = beta = 90.0, gamma = 120.0 degrees.
20005866 The binding of Grb2 adaptor to its downstream partners Sos1 and Gab1 docker is under tight allosteric regulation.
19924227 the beta-catenin-dependent Wnt pathway is integrated with integrin signaling through the adaptor molecule Grb2
19913121 Observational study of gene-disease association. (HuGE Navigator)
19735729 report that FGFR2 recruits Grb2 through its C-terminal SH3 domain.
19716163 findings support a role for growth factor receptor-bound protein 2 in the diagnostically challenging workup of classical Hodgkin lymphoma versus primary mediastinal large B-cell lymphoma
19682241 The novel platelet adapter Dok-3 and the structurally related Dok-1 are tyrosine phosphorylated in an Src kinase-independent manner downstream of alphaIIbbeta3 in human platelets, leading to an interaction with Grb2.
19668218 Recruitment of the cytoplasmic adaptor Grb2 to surface IgG and IgE provides antigen receptor-intrinsic costimulation to class-switched B cells.
19523899 Distinct binding modes of two epitopes in GAB2 that interact with the SH3C domain of GRB2 are reported.
19337752 Overexpression of Grb2 is associated with gastric cancer.
19323566 SH3 domains of GrB2 adaptor protein bind to PXpsiPXR motifs within the Sos1 nucleotide exchange factor in a discriminate manner.
19289468 Loss of MADD expression resulted in reduced Grb2 and Sos1/2 recruitment to the TNFR1 complex and decreased Ras and MEKK1/2 activation
19273609 Results define a novel negative cross-regulation between prolactin and epidermal growth factor involving the Jak2/Stat5a and Ras/MAPK pathways through tyrosine phosphorylation of Grb2.
18789888 These data reveal that Grb2 facilitates the association of FasL with adaptin beta, and promotes sorting of FasL to the cell surface.
18778683 Structural basis of the differential binding of the SH3 domains of GRB2 to SOS1 are reported.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18467332 tau interactions with Src homology 3 domains of phosphatidylinositol 3-kinase, phospholipase Cgamma1, Grb2, and Src family kinases are regulated by phosphorylation
18425376 Grb2 may have a role in tumor growth, invasiveness and metastasis
18420583 in VSMCs exposed to hyperglycemia, IGF-I stimulation of Shc facilitates the transfer of Grb2 to p85 resulting in enhanced PI3K activation and AKT phosphorylation leading to enhanced cell proliferation and migration
18307981 Thus, binding to APPL1 helps localize OCRL at specific cellular sites, and disruption of this interaction may play a role in disease.
18258597 Neph1 but not nephrin specifically binds to adaptor protein Grb2 and tyrosine kinase Csk in a phosphorylation-dependent manner.
18231572 In human uterine leiomyomas, GRB2 were also overexpressed.
18192688 tumors expressing Grb2- and Shc-recruiting Met receptors demonstrated a marked loss in Grb2-associated adaptor protein 1 (Gab1) protein levels, which was not observed in the cell lines, consistent with a post-translationally regulated process
18003605 These results suggest that coupling of Grb2 to Gab1 mediates the hepatocyte growth factor-induced strong activation of the ERK pathway, which is required for the inhibition of HepG2 cell proliferation.
17991782 examination of rate of association reactions between Grb2 and epidermal growth factor receptor
17849173 Grb2 functions as a factor which mediates phosphorylation of AMPK at Thr172.
17689925 These results are evidence that the Sprouty2 mechanism of ERK inhibition is independent of Grb2 binding.
17616655 Grb2 Src homology-2 domain-mediated interactions have a critical role in metastatic spread of primary solid tumors and Grb2 is inhibited by C90
17466257 biophysical analysis of Grb2-SH2 domain-swapping
16955467 By lysing primary hemopoietic cells at high pH, BCR-ABL1 protein-degradative activity was inhibited & association between BCR-ABL1 protein in complexes with adaptor proteins CBL, CRKL & GRB2 in primary chronic myeloid leukaemia material was demonstrated
16906159 In T cells, the SH2 domain of GRB2 binds phosphorylated tyrosines on the adaptor protein LAT and the GRB2 SH3 domains associate with the proline-rich regions of SOS1 and CBL.
16818765 Grb2 is not essential for CD28-mediated NF-kappa B activation. The interaction between the YMNM motif of CD28 and the SH2 domain is sufficient for Grb2 binding.
16760435 The full-length Grb2 proteins mediate negative regulation of the intrinsic Ras guanine-nucleotide exchange activity of hSos1.
16729043 EGFR has six binding sites for the adapter protein Grb2, and ErbB4 has five.
16436505 Grb3-3, an isoform of Grb2, is upregulated by HIV-1 Nef protein and potentiates HIV-1 LTR promoter activity
16407827 Y(169) and Y(179) are located within two consensus sites in PLD2 that mediate an SH2 interaction with Grb2. Y(169) and Y(179) are located within two consensus sites in PLD2 that mediate an SH2 interaction with Grb2.
16382132 EGFR-induced signaling and Grb2 are essential for formation of clathrin-coated pits accommodating the EGFR, while activation of MAPK and PI3K is not required.
16038803 Grb2, in addition to its key function in signaling through Ras, may have a negatively regulatory role on EGF-induced PLC-gamma1 activation.
15879090 Src homology 2 domain of Grb2 and the tyrosine residue tyrosine606 in CD229 are required for CD229-Grb2 complex formation.
15688026 p52Shc couples tyrosine kinase receptors to Ras by recruiting Grb2.
15635092 Grb2-mediated recruitment of the functional RING domain of Cbl to the EGFR is essential and sufficient to support receptor endocytosis
15467741 demonstrate an interaction between Grb2 and magicin
15368963 Peptides with very high affinity for Grb2 were rationally designed as possible antitumor agents (review)
15326489 GRB2 is necessary for RET-mediated branching of MDCK cells
15314156 Results suggest that MUC20 is a novel regulator of the Met signaling cascade which has a role in suppression of the Grb2-Ras pathway.
15182856 catalase (447)Tyr-Val-Asn-Val binds Grb2 upon phosphorylation in tumor cells when stimulated with serum or ligands for integrin receptors
15122321 PNRC and Grb2, by interacting with each other, can suppress nuclear receptor-mediated regulation and growth factor-mediated regulation in human breast tissue
12748278 Results demonstrate that p27(Kip1) can inhibit growth factor receptor-bound protein 2 function by blocking its association with the guanine nucleotide exchange factor SOS.
12522133 p21-activated kinase 1 (PAK1) interacts with the Grb2 adapter protein to couple to growth factor signaling
12399475 mediates recruitment of the Rab5 GTPase-activating protein RN-tre in endocyosis of EGFR
12186904 results suggest a model in which hepatitis C virus NS5A interacts with Grb2 to inhibit mitogenic signaling while simultaneously promoting the PI3K-AKT cell survival pathway by interaction with p85 PI3K
12162872 grb2 tyrosine phosphorylation was decreased in Couzon syndrome.
12007418 Grb2 and Nck act cooperatively to promote actin-based motility of vaccinia virus
12006650 Coordinated traffic of Grb2 and Ras during epidermal growth factor receptor endocytosis
11997181 Results indicate that leptin, after binding its receptor, leads to activation of Grb2 and several pathways for signal transduction that might lead to mitogenic effects.
11897833 Investigation of the GRB2, GRB7, and CSH1 genes as candidates for the Silver-Russell syndrome (SRS) on chromosome 17q.
11006130 Grb3-3, an isoform of Grb2, is upregulated by HIV-1 Nef protein and potentiates HIV-1 LTR promoter activity
10906142 Grb3-3, an isoform of Grb2, is upregulated by HIV-1 Nef protein and potentiates HIV-1 LTR promoter activity
9013873 Vav associates with Grb2.

AA Sequence

MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKIPRAKA      1 - 70
EEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSV     71 - 140
SRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYV    141 - 210
TPVNRNV                                                                   211 - 217
//

Text Mined References (540)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27059931 2016 Weak binding to E3 ubiquitin ligase c-Cbl increases EGFRvA protein stability.
26511382 2015 TGF-?2 induces Grb2 to recruit PI3-K to TGF-RII that activates JNK/AP-1-signaling and augments invasiveness of Theileria-transformed macrophages.
26188370 2015 Genome-wide association study for sight-threatening diabetic retinopathy reveals association with genetic variation near the GRB2 gene.
26103942 2015 Grb2 monomer-dimer equilibrium determines normal versus oncogenic function.
26079855 2015 Regions outside of conserved PxxPxR motifs drive the high affinity interaction of GRB2 with SH3 domain ligands.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25819436 2015 A single PXXP motif in the C-terminal region of srGAP3 mediates binding to multiple SH3 domains.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25688510 Dynamic expression changes between non-muscle-invasive bladder cancer and muscle-invasive bladder cancer.
25659534 2015 Quantitative proteomics reveals the downregulation of GRB2 as a prominent node of F806-targeted cell proliferation network.
25535246 2015 A THEMIS:SHP1 complex promotes T-cell survival.
25416956 2014 A proteome-scale map of the human interactome network.
25413232 2014 The immunoglobulin tail tyrosine motif upgrades memory-type BCRs by incorporating a Grb2-Btk signalling module.
25041730 2014 Mutant huntingtin replaces Gab1 and interacts with C-terminal SH3 domain of growth factor receptor binding protein 2 (Grb2).
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
25031732 2014 Overexpression of GRB2 is correlated with lymph node metastasis and poor prognosis in esophageal squamous cell carcinoma.
24939894 2014 The kinase LMTK3 promotes invasion in breast cancer through GRB2-mediated induction of integrin ??.
24882360 2014 Interaction of Grb2 SH3 domain with UVRAG in an Alzheimer's disease-like scenario.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24708867 2014 Met receptor-induced Grb2 or Shc signals both promote transformation of intestinal epithelial cells, albeit they are required for distinct oncogenic functions.
24697349 2014 Recruitment of the adaptor protein Grb2 to EGFR tetramers.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24440983 2014 Competition between Grb2 and Plc?1 for FGFR2 regulates basal phospholipase activity and invasion.
24407288 2014 The adaptor proteins p66Shc and Grb2 regulate the activation of the GTPases ARF1 and ARF6 in invasive breast cancer cells.
24399467 2014 Grb2 interacts with SGEF and antagonizes the ability of SGEF to enhance EGF-induced ERK1/2 activation.
24391994 2013 Identification of GRB2 and GAB1 coexpression as an unfavorable prognostic factor for hepatocellular carcinoma by a combination of expression profile and network analysis.
24259669 2014 Live-cell fluorescence imaging reveals high stoichiometry of Grb2 binding to the EGF receptor sustained during endocytosis.
24189400 2013 Perturbation of the mutated EGFR interactome identifies vulnerabilities and resistance mechanisms.
24100123 2014 Growth factor receptor-bound protein 2 promotes autophagic removal of amyloid-? protein precursor intracellular domain overload in neuronal cells.
24098653 2013 High resolution crystal structure of the Grb2 SH2 domain with a phosphopeptide derived from CD28.
23946459 2013 Role of herpes simplex virus VP11/12 tyrosine-based motifs in binding and activation of the Src family kinase Lck and recruitment of p85, Grb2, and Shc.
23922722 2013 MiR-376c down-regulation accelerates EGF-dependent migration by targeting GRB2 in the HuCCT1 human intrahepatic cholangiocarcinoma cell line.
23916875 A deficient translocation of CD3?, ZAP-70 and Grb2 to lipid raft, as a hallmark of defective adaptive immune response during chronic hepatitis B infection.
23799367 2013 Threshold-controlled ubiquitination of the EGFR directs receptor fate.
23771793 2013 Suppression of Grb2 expression improved hepatic steatosis, oxidative stress, and apoptosis induced by palmitic acid in vitro partly through insulin signaling alteration.
23700486 2013 Profiling epidermal growth factor receptor and heregulin receptor 3 heteromerization using receptor tyrosine kinase heteromer investigation technology.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23460737 2013 GRB2-mediated recruitment of THEMIS to LAT is essential for thymocyte development.
23420874 2013 Grb2 controls phosphorylation of FGFR2 by inhibiting receptor kinase and Shp2 phosphatase activity.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23334917 2013 Allostery mediates ligand binding to Grb2 adaptor in a mutually exclusive manner.
23223229 2013 The Dok-3/Grb2 protein signal module attenuates Lyn kinase-dependent activation of Syk kinase in B cell antigen receptor microclusters.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23178716 2013 SnoN/SkiL expression is modulated via arsenic trioxide-induced activation of the PI3K/AKT pathway in ovarian cancer cells.
23159538 2013 Unusual binding of Grb2 protein to a bivalent polyproline-ligand immobilized on a SPR sensor: intermolecular bivalent binding.
23154388 2013 Recruitment of Grb2 and SHIP1 by the ITT-like motif of TIGIT suppresses granule polarization and cytotoxicity of NK cells.
23131845 2012 Grb2, a double-edged sword of receptor tyrosine kinase signaling.
22882974 2012 Cell-surface metalloprotease ADAM12 is internalized by a clathrin- and Grb2-dependent mechanism.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22726438 2012 Inhibition of basal FGF receptor signaling by dimeric Grb2.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22561606 2012 Tespa1 is involved in late thymocyte development through the regulation of TCR-mediated signaling.
22536782 2012 Bivalent binding drives the formation of the Grb2-Gab1 signaling complex in a noncooperative manner.
22505611 2012 Grb2 mediates semaphorin-4D-dependent RhoA inactivation.
22396725 2012 Modeling and simulation of aggregation of membrane protein LAT with molecular variability in the number of binding sites for cytosolic Grb2-SOS1-Grb2.
22360309 2012 Multivalent binding and facilitated diffusion account for the formation of the Grb2-Sos1 signaling complex in a cooperative manner.
22344067 2012 TCR-mediated Erk activation does not depend on Sos and Grb2 in peripheral human T cells.
22327338 2012 c-ABL modulates MAP kinases activation downstream of VEGFR-2 signaling by direct phosphorylation of the adaptor proteins GRB2 and NCK1.
22323290 2012 FCH domain only-2 organizes clathrin-coated structures and interacts with Disabled-2 for low-density lipoprotein receptor endocytosis.
22094095 2011 [Mechanisms of focal adhesion kinase in the proliferation of human pulmonary artery smooth cells under hypoxia].
22027826 2011 ACAP4 protein cooperates with Grb2 protein to orchestrate epidermal growth factor-stimulated integrin ?1 recycling in cell migration.
22001015 2011 Functional implications of the conformational switch in AICD peptide upon binding to Grb2-SH2 domain.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21930792 2011 SCIMP, a transmembrane adaptor protein involved in major histocompatibility complex class II signaling.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21822214 2011 The B-cell antigen receptor signals through a preformed transducer module of SLP65 and CIN85.
21745501 2011 HIV-1 Tat binds to SH3 domains: cellular and viral outcome of Tat/Grb2 interaction.
21725358 2012 The SRC-associated protein CUB Domain-Containing Protein-1 regulates adhesion and motility.
21725282 2011 Activation of Src and transformation by an RPTP? splice mutant found in human tumours.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
21508312 2011 GRB2 couples RhoU to epidermal growth factor receptor signaling and cell migration.
21278788 2011 Translationally controlled tumor protein induces human breast epithelial cell transformation through the activation of Src.
21278786 2011 PI3K inhibition results in enhanced HER signaling and acquired ERK dependency in HER2-overexpressing breast cancer.
21269460 2011 Initial characterization of the human central proteome.
21195589 2011 Application of systems biology approach identifies and validates GRB2 as a risk gene for schizophrenia in the Irish Case Control Study of Schizophrenia (ICCSS) sample.
21185312 2011 Genetic incorporation of a photo-crosslinkable amino acid reveals novel protein complexes with GRB2 in mammalian cells.
21179510 2010 Histidine domain-protein tyrosine phosphatase interacts with Grb2 and GrpL.
21072043 2011 Inhibition of Grb2 expression demonstrates an important role in BCR-ABL-mediated MAPK activation and transformation of primary human hematopoietic cells.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20936779 2010 A human MAP kinase interactome.
20850195 Nck1 and Grb2 localization patterns can distinguish invadopodia from podosomes.
20700730 2010 Microarray analysis of differentially expressed genes in vaginal tissues in postmenopausal women. The role of stress urinary incontinence.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20618341 2010 Triggering Ras signalling by intracellular Francisella tularensis through recruitment of PKC? and ?I to the SOS2/GrB2 complex is essential for bacterial proliferation in the cytosol.
20596655 2010 Basic study on SH2 domain of Grb2 as a molecular probe for detection of RTK activation.
20554525 2010 Involvement of Grb2 adaptor protein in nucleophosmin-anaplastic lymphoma kinase (NPM-ALK)-mediated signaling and anaplastic large cell lymphoma growth.
20521079 2010 Recruitment of Pyk2 to SHPS-1 signaling complex is required for IGF-I-dependent mitogenic signaling in vascular smooth muscle cells.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20160708 2010 Feedback between p21 and reactive oxygen production is necessary for cell senescence.
20124721 2010 Preliminary crystallographic characterization of the Grb2 SH2 domain in complex with a FAK-derived phosphotyrosyl peptide.
20086093 2010 HECT E3 ubiquitin ligase Nedd4-1 ubiquitinates ACK and regulates epidermal growth factor (EGF)-induced degradation of EGF receptor and ACK.
20005866 2010 Assembly of the Sos1-Grb2-Gab1 ternary signaling complex is under allosteric control.
19924227 2009 Integration of the beta-catenin-dependent Wnt pathway with integrin signaling through the adaptor molecule Grb2.
19914172 2009 KIF26A is an unconventional kinesin and regulates GDNF-Ret signaling in enteric neuronal development.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19836242 2009 An unbiased screen identifies DEP-1 tumor suppressor as a phosphatase controlling EGFR endocytosis.
19815557 2009 Cytoplasmic ACK1 interaction with multiple receptor tyrosine kinases is mediated by Grb2: an analysis of ACK1 effects on Axl signaling.
19798056 2009 Participation of Tom1L1 in EGF-stimulated endocytosis of EGF receptor.
19735729 2010 Direct binding of Grb2 SH3 domain to FGFR2 regulates SHP2 function.
19716163 2009 Expression of Grb2 distinguishes classical Hodgkin lymphomas from primary mediastinal B-cell lymphomas and other diffuse large B-cell lymphomas.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19682241 2009 Proteomic analysis of integrin alphaIIbbeta3 outside-in signaling reveals Src-kinase-independent phosphorylation of Dok-1 and Dok-3 leading to SHIP-1 interactions.
19668218 2009 Recruitment of the cytoplasmic adaptor Grb2 to surface IgG and IgE provides antigen receptor-intrinsic costimulation to class-switched B cells.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19523899 2009 Distinct binding modes of two epitopes in Gab2 that interact with the SH3C domain of Grb2.
19509291 2009 GAREM, a novel adaptor protein for growth factor receptor-bound protein 2, contributes to cellular transformation through the activation of extracellular signal-regulated kinase signaling.
19380743 2009 Charting the molecular network of the drug target Bcr-Abl.
19337752 2009 Overexpression of Grb2/HER2 signaling in Chinese gastric cancer: their relationship with clinicopathological parameters and prognostic significance.
19323566 2009 SH3 domains of Grb2 adaptor bind to PXpsiPXR motifs within the Sos1 nucleotide exchange factor in a discriminate manner.
19289468 2009 MADD, a splice variant of IG20, is indispensable for MAPK activation and protection against apoptosis upon tumor necrosis factor-alpha treatment.
19273609 2009 Tyrosine phosphorylation of Grb2: role in prolactin/epidermal growth factor cross talk in mammary epithelial cell growth and differentiation.
19172738 2008 Phosphorylation-dependent binding of 14-3-3 terminates signalling by the Gab2 docking protein.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18789888 2008 The adaptor protein Grb2 regulates cell surface Fas ligand in Schwann cells.
18778683 2008 Structural basis of the differential binding of the SH3 domains of Grb2 adaptor to the guanine nucleotide exchange factor Sos1.
18692475 2008 A protein domain-based interactome network for C. elegans early embryogenesis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18654987 2008 Identification of multi-SH3 domain-containing protein interactome in pancreatic cancer: a yeast two-hybrid approach.
18647389 2008 The central proline rich region of POB1/REPS2 plays a regulatory role in epidermal growth factor receptor endocytosis by binding to 14-3-3 and SH3 domain-containing proteins.
18624398 2008 Protein interaction data set highlighted with human Ras-MAPK/PI3K signaling pathways.
18559951 2008 Identification of a new transmembrane adaptor protein that constitutively binds Grb2 in B cells.
18467332 2008 Phosphorylation regulates tau interactions with Src homology 3 domains of phosphatidylinositol 3-kinase, phospholipase Cgamma1, Grb2, and Src family kinases.
18425376 2008 New insight into the key proteins and pathways involved in the metastasis of colorectal carcinoma.
18420583 2008 Insulin-like growth factor-I stimulates Shc-dependent phosphatidylinositol 3-kinase activation via Grb2-associated p85 in vascular smooth muscle cells.
18307981 2008 All known patient mutations in the ASH-RhoGAP domains of OCRL affect targeting and APPL1 binding.
18296648 2008 Distinct functions of natural ADAM-15 cytoplasmic domain variants in human mammary carcinoma.
18273061 2008 Structural basis for a novel intrapeptidyl H-bond and reverse binding of c-Cbl-TKB domain substrates.
18258597 2008 Neph1, a component of the kidney slit diaphragm, is tyrosine-phosphorylated by the Src family tyrosine kinase and modulates intracellular signaling by binding to Grb2.
18231572 Differential expression of receptor tyrosine kinases (RTKs) and IGF-I pathway activation in human uterine leiomyomas.
18192688 2008 Gab1 but not Grb2 mediates tumor progression in Met overexpressing colorectal cancer cells.
18003605 2008 Coupling of Grb2 to Gab1 mediates hepatocyte growth factor-induced high intensity ERK signal required for inhibition of HepG2 hepatoma cell proliferation.
17991782 2007 Multiple-state reactions between the epidermal growth factor receptor and Grb2 as observed by using single-molecule analysis.
17849173 2008 The function study on the interaction between Grb2 and AMPK.
17689925 2007 Sprouty2 binds Grb2 at two different proline-rich regions, and the mechanism of ERK inhibition is independent of this interaction.
17616655 2007 Inhibition of tumor metastasis by a growth factor receptor bound protein 2 Src homology 2 domain-binding antagonist.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17466257 2007 Structural and energetic aspects of Grb2-SH2 domain-swapping.
17276458 2007 The Grb2/PLD2 interaction is essential for lipase activity, intracellular localization and signaling in response to EGF.
17235283 2007 Efficient T-cell receptor signaling requires a high-affinity interaction between the Gads C-SH3 domain and the SLP-76 RxxK motif.
17094785 2006 Identification and functional characterization of an Src homology domain 3 domain-binding site on Cbl.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16955467 2006 Detection in primary chronic myeloid leukaemia cells of p210BCR-ABL1 in complexes with adaptor proteins CBL, CRKL, and GRB2.
16938345 2007 Evidence of LAT as a dual substrate for Lck and Syk in T lymphocytes.
16912232 2006 Human SLP-65 isoforms contribute differently to activation and apoptosis of B lymphocytes.
16906159 2006 Oligomerization of signaling complexes by the multipoint binding of GRB2 to both LAT and SOS1.
16899217 2006 Magicin associates with the Src-family kinases and is phosphorylated upon CD3 stimulation.
16893902 2006 A Src homology 3-binding sequence on the C terminus of Sprouty2 is necessary for inhibition of the Ras/ERK pathway downstream of fibroblast growth factor receptor stimulation.
16818765 2006 Grb2 and Gads exhibit different interactions with CD28 and play distinct roles in CD28-mediated costimulation.
16799092 2006 Dynamic profiling of the post-translational modifications and interaction partners of epidermal growth factor receptor signaling after stimulation by epidermal growth factor using Extended Range Proteomic Analysis (ERPA).
16760435 2006 Grb2 is a negative modulator of the intrinsic Ras-GEF activity of hSos1.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
16729043 2005 Phosphotyrosine interactome of the ErbB-receptor kinase family.
16696976 2006 Two mechanistically distinct forms of endocytosis in adrenal chromaffin cells: Differential effects of SH3 domains and amphiphysin antagonism.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16582911 2006 NKG2D-mediated signaling requires a DAP10-bound Grb2-Vav1 intermediate and phosphatidylinositol-3-kinase in human natural killer cells.
16520382 2006 Sos-mediated activation of rac1 by p66shc.
16407827 2006 The elucidation of novel SH2 binding sites on PLD2.
16382132 2006 Activation of the epidermal growth factor (EGF) receptor induces formation of EGF receptor- and Grb2-containing clathrin-coated pits.
16374509 2006 Identification of preferred protein interactions by phage-display of the human Src homology-3 proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16339550 2005 T cell activation-induced CrkII binding to the Zap70 protein tyrosine kinase is mediated by Lck-dependent phosphorylation of Zap70 tyrosine 315.
16298995 2006 EphB receptors regulate dendritic spine morphogenesis through the recruitment/phosphorylation of focal adhesion kinase and RhoA activation.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
16253990 2006 Increased proliferation and altered growth factor dependence of human mammary epithelial cells overexpressing the Gab2 docking protein.
16249387 2006 LIME acts as a transmembrane adapter mediating BCR-dependent B-cell activation.
16219545 2005 Intrinsic regulation of the interactions between the SH3 domain of p85 subunit of phosphatidylinositol-3 kinase and the protein network of BCR/ABL oncogenic tyrosine kinase.
16137687 2005 SNX9 as an adaptor for linking synaptojanin-1 to the Cdc42 effector ACK1.
16129412 2005 Signaling by Kit protein-tyrosine kinase--the stem cell factor receptor.
16038803 2005 Grb2 negatively regulates epidermal growth factor-induced phospholipase C-gamma1 activity through the direct interaction with tyrosine-phosphorylated phospholipase C-gamma1.
15929943 2005 Novel Src homology 3 domain-binding motifs identified from proteomic screen of a Pro-rich region.
15879090 2005 Identification of Grb2 as a novel binding partner of the signaling lymphocytic activation molecule-associated protein binding receptor CD229.
15834155 2005 Kinetics of Src homology 3 domain association with the proline-rich domain of dynamins: specificity, occlusion, and the effects of phosphorylation.
15784897 2005 Further studies on hepatitis C virus NS5A-SH3 domain interactions: identification of residues critical for binding and implications for viral RNA replication and modulation of cell signalling.
15688026 2005 Cooperation and selectivity of the two Grb2 binding sites of p52Shc in T-cell antigen receptor signaling to Ras family GTPases and Myc-dependent survival.
15677445 2005 Distinct turnover of alternatively spliced isoforms of the RET kinase receptor mediated by differential recruitment of the Cbl ubiquitin ligase.
15657067 2005 Phosphotyrosine signaling networks in epidermal growth factor receptor overexpressing squamous carcinoma cells.
15635092 2005 Growth factor receptor binding protein 2-mediated recruitment of the RING domain of Cbl to the epidermal growth factor receptor is essential and sufficient to support receptor endocytosis.
15574420 2005 A novel role for Gab1 and SHP2 in epidermal growth factor-induced Ras activation.
15558030 2005 Characterization of VIK-1: a new Vav-interacting Kruppel-like protein.
15556869 2004 Atypical mechanism of regulation of the Wrch-1 Rho family small GTPase.
15546961 2005 Novel interaction partners of the TPR/MET tyrosine kinase.
15536091 2005 Fyn phosphorylates human MAP-2c on tyrosine 67.
15526160 2004 Signal transduction via the stem cell factor receptor/c-Kit.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15488758 2004 TrkA alternative splicing: a regulated tumor-promoting switch in human neuroblastoma.
15467741 2004 Magicin, a novel cytoskeletal protein associates with the NF2 tumor suppressor merlin and Grb2.
15368963 2004 [Design of new anti-tumor agents interrupting deregulated signaling pathways induced by tyrosine kinase proteins. Inhibition of protein-protein interaction involving Grb2].
15326489 2004 Differential requirement of Tyr1062 multidocking site by RET isoforms to promote neural cell scattering and epithelial cell branching.
15314156 2004 MUC20 suppresses the hepatocyte growth factor-induced Grb2-Ras pathway by binding to a multifunctional docking site of met.
15302586 2004 The c-Fes tyrosine kinase cooperates with the breakpoint cluster region protein (Bcr) to induce neurite extension in a Rac- and Cdc42-dependent manner.
15187135 2004 Binding of cytoplasmic proteins to the CD19 intracellular domain is high affinity, competitive, and multimeric.
15182856 2004 Catalase binds Grb2 in tumor cells when stimulated with serum or ligands for integrin receptors.
15173068 2004 Human epidermal growth factor receptor 2 status modulates subcellular localization of and interaction with estrogen receptor alpha in breast cancer cells.
15122321 2004 A novel crosstalk mechanism between nuclear receptor-mediated and growth factor/Ras-mediated pathways through PNRC-Grb2 interaction.
15102829 2004 Activation of vascular endothelial growth factor receptor-3 and its downstream signaling promote cell survival under oxidative stress.
14993658 2004 The hepatitis C virus NS5A protein binds to members of the Src family of tyrosine kinases and regulates kinase activity.
14985334 2004 Analysis of clathrin-mediated endocytosis of epidermal growth factor receptor by RNA interference.
14722116 2004 The importance of three membrane-distal tyrosines in the adaptor protein NTAL/LAB.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14679214 2004 A novel proteomic screen for peptide-protein interactions.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14665621 2004 Roles of Gab1 and SHP2 in paxillin tyrosine dephosphorylation and Src activation in response to epidermal growth factor.
14560030 2003 Molecular mechanism for a role of SHP2 in epidermal growth factor receptor signaling.
13129930 2003 Structural insight into modest binding of a non-PXXP ligand to the signal transducing adaptor molecule-2 Src homology 3 domain.
12925710 2003 EphB1 recruits c-Src and p52Shc to activate MAPK/ERK and promote chemotaxis.
12852788 2003 Adaptor signalling proteins Grb2 and Grb7 are recruited by human G6f, a novel member of the immunoglobulin superfamily encoded in the MHC.
12748278 2003 p27Kip1 inhibition of GRB2-SOS formation can regulate Ras activation.
12730204 2003 Overexpression of plasma membrane-associated sialidase attenuates insulin signaling in transgenic mice.
12624098 2003 The inhibitory gamma subunit of the type 6 retinal cGMP phosphodiesterase functions to link c-Src and G-protein-coupled receptor kinase 2 in a signaling unit that regulates p42/p44 mitogen-activated protein kinase by epidermal growth factor.
12577067 2003 A proteomics strategy to elucidate functional protein-protein interactions applied to EGF signaling.
12531430 2003 The adaptor function of SHP-2 downstream of the prolactin receptor is required for the recruitment of p29, a substrate of SHP-2.
12529371 2003 p21-activated protein kinase 4 (PAK4) interacts with the keratinocyte growth factor receptor and participates in keratinocyte growth factor-mediated inhibition of oxidant-induced cell death.
12522133 2003 p21-activated kinase 1 (PAK1) interacts with the Grb2 adapter protein to couple to growth factor signaling.
12514734 2003 LAB: a new membrane-associated adaptor molecule in B cell activation.
12486104 2002 Non-T cell activation linker (NTAL): a transmembrane adaptor protein involved in immunoreceptor signaling.
12485888 2002 Signal transduction through tyrosine-phosphorylated carboxy-terminal fragments of APP via an enhanced interaction with Shc/Grb2 adaptor proteins in reactive astrocytes of Alzheimer's disease brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475979 2003 Hepatocyte growth factor receptor tyrosine kinase met is a substrate of the receptor protein-tyrosine phosphatase DEP-1.
12441060 2002 Fear memory formation involves p190 RhoGAP and ROCK proteins through a GRB2-mediated complex.
12424224 2003 NEPH1 defines a novel family of podocin interacting proteins.
12402043 2002 Sprouty1 and Sprouty2 provide a control mechanism for the Ras/MAPK signalling pathway.
12400011 2002 Activation of the EphA2 tyrosine kinase stimulates the MAP/ERK kinase signaling cascade.
12399475 2002 Endocytosis of epidermal growth factor receptor regulated by Grb2-mediated recruitment of the Rab5 GTPase-activating protein RN-tre.
12388170 2003 Protein-tyrosine-phosphatase 1B activation is regulated developmentally in muscle of neonatal pigs.
12359715 2002 Molecular cloning of a novel gene encoding a membrane-associated adaptor protein (LAX) in lymphocyte signaling.
12345679 1994 Non-aligned movement support for South-South collaboration in the field of population and family planning.
12242309 2002 The neuron-specific Rai (ShcC) adaptor protein inhibits apoptosis by coupling Ret to the phosphatidylinositol 3-kinase/Akt signaling pathway.
12242006 2002 Organization of the mouse Ruk locus and expression of isoforms in mouse tissues.
12220636 2002 The COOH-terminus of parathyroid hormone-related protein (PTHrP) interacts with beta-arrestin 1B.
12213123 2002 Novel peptide inhibitors for Grb2 SH2 domain and their detection by surface plasmon resonance.
12186904 2002 Subversion of cell signaling pathways by hepatitis C virus nonstructural 5A protein via interaction with Grb2 and P85 phosphatidylinositol 3-kinase.
12171928 2002 SKAP55 recruits to lipid rafts and positively mediates the MAPK pathway upon T cell receptor activation.
12162872 2002 Basic fibroblast growth factor: effects on matrix remodeling, receptor expression, and transduction pathway in human periosteal fibroblasts with FGFR2 gene mutation.
12149229 2002 TEL-JAK2 constitutively activates the extracellular signal-regulated kinase (ERK), stress-activated protein/Jun kinase (SAPK/JNK), and p38 signaling pathways.
12112020 2002 Sam68 associates with the SH3 domains of Grb2 recruiting GAP to the Grb2-SOS complex in insulin receptor signaling.
12091307 2002 unc-53 controls longitudinal migration in C. elegans.
12023017 2002 Identification of interaction partners of the cytosolic polyproline region of CD95 ligand (CD178).
12007418 2002 Grb2 and Nck act cooperatively to promote actin-based motility of vaccinia virus.
12006650 2002 Coordinated traffic of Grb2 and Ras during epidermal growth factor receptor endocytosis visualized in living cells.
11997436 2002 FRS2 alpha attenuates FGF receptor signaling by Grb2-mediated recruitment of the ubiquitin ligase Cbl.
11997181 2002 Leptin promotes the tyrosine phosphorylation of SHC proteins and SHC association with GRB2.
11964172 2002 Differential effect of the inhibition of Grb2-SH3 interactions in platelet activation induced by thrombin and by Fc receptor engagement.
11960376 2002 UCS15A, a novel small molecule, SH3 domain-mediated protein-protein interaction blocking drug.
11923305 2002 Mitotic activation of protein-tyrosine phosphatase alpha and regulation of its Src-mediated transforming activity by its sites of protein kinase C phosphorylation.
11912194 2002 Insulin receptor substrate 4 associates with the protein IRAS.
11897833 2002 Investigation of the GRB2, GRB7, and CSH1 genes as candidates for the Silver-Russell syndrome (SRS) on chromosome 17q.
11896612 2002 Use of signal specific receptor tyrosine kinase oncoproteins reveals that pathways downstream from Grb2 or Shc are sufficient for cell transformation and metastasis.
11894095 2002 Cbl-CIN85-endophilin complex mediates ligand-induced downregulation of EGF receptors.
11882361 2002 The lymphoid protein tyrosine phosphatase Lyp interacts with the adaptor molecule Grb2 and functions as a negative regulator of T-cell activation.
11877424 2002 Dynamin is a minibrain kinase/dual specificity Yak1-related kinase 1A substrate.
11827484 2002 Crystal structures of the SH2 domain of Grb2: highlight on the binding of a new high-affinity inhibitor.
11823423 2002 A mutant EGF-receptor defective in ubiquitylation and endocytosis unveils a role for Grb2 in negative signaling.
11741929 2002 Phosphorylation-dependent interactions between ADAM15 cytoplasmic domain and Src family protein-tyrosine kinases.
11741599 2001 Multiple interactions of the cytosolic polyproline region of the CD95 ligand: hints for the reverse signal transduction capacity of a death factor.
11739737 2002 Gab3, a new DOS/Gab family member, facilitates macrophage differentiation.
11733534 2002 Expression of full-length polyglutamine-expanded Huntingtin disrupts growth factor receptor signaling in rat pheochromocytoma (PC12) cells.
11726515 2001 Tyrosine phosphorylation of Grb2 by Bcr/Abl and epidermal growth factor receptor: a novel regulatory mechanism for tyrosine kinase signaling.
11711534 2002 'Srcasm: a novel Src activating and signaling molecule.
11707405 2001 ShcA tyrosine phosphorylation sites can replace ShcA binding in signalling by middle T-antigen.
11707404 2001 ShcA and Grb2 mediate polyoma middle T antigen-induced endothelial transformation and Gab1 tyrosine phosphorylation.
11684012 2001 Site-specific incorporation of a phosphotyrosine mimetic reveals a role for tyrosine phosphorylation of SHP-2 in cell signaling.
11606575 2001 Hyaluronan promotes CD44v3-Vav2 interaction with Grb2-p185(HER2) and induces Rac1 and Ras signaling during ovarian tumor cell migration and growth.
11606067 2001 Unique phosphorylation mechanism of Gab1 using PI 3-kinase as an adaptor protein.
11571277 2001 PrPC directly interacts with proteins involved in signaling pathways.
11551923 2001 CD22 regulates B cell receptor-mediated signals via two domains that independently recruit Grb2 and SHP-1.
11551227 2001 Mouse alpha1-syntrophin binding to Grb2: further evidence of a role for syntrophin in cell signaling.
11546790 2001 Binding of Fyn to MAP-2c through an SH3 binding domain. Regulation of the interaction by ERK2.
11533253 2001 Recruitment of the class II phosphoinositide 3-kinase C2beta to the epidermal growth factor receptor: role of Grb2.
11527382 2001 Through induction of juxtaposition and tyrosine kinase activity of Jak1, X-gene product of hepatitis B virus stimulates Ras and the transcriptional activation through AP-1, NF-kappaB, and SRE enhancers.
11520933 2001 Nerve growth factor signaling, neuroprotection, and neural repair.
11518702 2001 The ORF3 protein of hepatitis E virus binds to Src homology 3 domains and activates MAPK.
11509578 2001 mDia-interacting protein acts downstream of Rho-mDia and modifies Src activation and stress fiber formation.
11483358 2001 Differential expression and subcellular distribution of the mouse metastasis-associated proteins Mta1 and Mta3.
11466354 2001 Cross-linking of EphB6 resulting in signal transduction and apoptosis in Jurkat cells.
11439336 2001 Hepatocyte Growth Factor/scatter factor-induces phosphorylation of cortactin in A431 cells in a Src kinase-independent manner.
11433379 2001 Structural and functional dissection of the cytoplasmic domain of the transmembrane adaptor protein SIT (SHP2-interacting transmembrane adaptor protein).
11432792 2001 Analysis of tyrosine phosphorylation-dependent protein-protein interactions in TrkB-mediated intracellular signaling using modified yeast two-hybrid system.
11384839 2001 SH3 ligands in the dopamine D3 receptor.
11371563 2001 The inhibitory role of DOC-2/DAB2 in growth factor receptor-mediated signal cascade. DOC-2/DAB2-mediated inhibition of ERK phosphorylation via binding to Grb2.
11353842 2001 Stimulation of phosphatidylinositol 3-kinase by fibroblast growth factor receptors is mediated by coordinated recruitment of multiple docking proteins.
11352655 2001 Electroconvulsive shock increases the phosphorylation of Pyk2 in the rat hippocampus.
11314042 2001 The C-terminal SH3 domain of the adapter protein Grb2 binds with high affinity to sequences in Gab1 and SLP-76 which lack the SH3-typical P-x-x-P core motif.
11292345 2001 Selection of ligands by panning of domain libraries displayed on phage lambda reveals new potential partners of synaptojanin 1.
11278754 2001 Direct binding of the signal-transducing adaptor Grb2 facilitates down-regulation of the cyclin-dependent kinase inhibitor p27Kip1.
11278583 2001 Multiple effector domains within SNT1 coordinate ERK activation and neuronal differentiation of PC12 cells.
11278465 2001 The tyrosine kinase Hck is an inhibitor of HIV-1 replication counteracted by the viral vif protein.
11173924 2001 Neuregulin-induced association of Sos Ras exchange protein with HER2(erbB2)/HER3(erbB3) receptor complexes in Schwann cells through a specific Grb2-HER2(erbB2) interaction.
11157975 2001 A novel neural Wiskott-Aldrich syndrome protein (N-WASP) binding protein, WISH, induces Arp2/3 complex activation independent of Cdc42.
11152963 2000 SETA is a multifunctional adapter protein with three SH3 domains that binds Grb2, Cbl, and the novel SB1 proteins.
11133830 2001 The involvement of the proto-oncogene p120 c-Cbl and ZAP-70 in CD2-mediated T cell activation.
11127814 2000 Meltrin alpha cytoplasmic domain interacts with SH3 domains of Src and Grb2 and is phosphorylated by v-Src.
11094073 2000 Vav3 mediates receptor protein tyrosine kinase signaling, regulates GTPase activity, modulates cell morphology, and induces cell transformation.
11071869 2000 Characterization of the CIN85 adaptor protein and identification of components involved in CIN85 complexes.
11063574 2000 Dimer formation through domain swapping in the crystal structure of the Grb2-SH2-Ac-pYVNV complex.
10982817 2000 A deubiquitinating enzyme UBPY interacts with the Src homology 3 domain of Hrs-binding protein via a novel binding motif PX(V/I)(D/N)RXXKP.
10980613 2000 Generation of novel cytoplasmic forms of protein tyrosine phosphatase epsilon by proteolytic processing and translational control.
10973965 2000 Epidermal growth factor-induced phosphatidylinositol 3-kinase activation and DNA synthesis. Identification of Grb2-associated binder 2 as the major mediator in rat hepatocytes.
10970810 2000 The beta-subunit of the hepatocyte growth factor/scatter factor (HGF/SF) receptor phosphorylates and associates with CrkII: expression of CrkII enhances HGF/SF-induced mitogenesis.
10942756 2000 Interaction of linker for activation of T cells with multiple adapter proteins in platelets activated by the glycoprotein VI-selective ligand, convulxin.
10940929 2000 Engagement of the T lymphocyte antigen receptor regulates association of son-of-sevenless homologues with the SH3 domain of phospholipase Cgamma1.
10940627 2000 Human SPRY2 inhibits FGF2 signalling by a secreted factor.
10913131 2000 Identification of an atypical Grb2 carboxyl-terminal SH3 domain binding site in Gab docking proteins reveals Grb2-dependent and -independent recruitment of Gab1 to receptor tyrosine kinases.
10903901 2000 Characterization of the beta-dystroglycan-growth factor receptor 2 (Grb2) interaction.
10900203 2000 p135 src homology 2 domain-containing inositol 5'-phosphatase (SHIPbeta ) isoform can substitute for p145 SHIP in fcgamma RIIB1-mediated inhibitory signaling in B cells.
10899172 2000 Specificity of the binding of synapsin I to Src homology 3 domains.
10887132 2000 The Grb2 binding site is required for the induction of chronic myeloid leukemia-like disease in mice by the Bcr/Abl tyrosine kinase.
10867024 2000 Ligand discrimination in signaling through an ErbB4 receptor homodimer.
10820378 2000 BLNK is associated with the CD72/SHP-1/Grb2 complex in the WEHI231 cell line after membrane IgM cross-linking.
10811803 2000 Association of Grb2, Gads, and phospholipase C-gamma 1 with phosphorylated LAT tyrosine residues. Effect of LAT tyrosine mutations on T cell angigen receptor-mediated signaling.
10790433 2000 Phosphoprotein associated with glycosphingolipid-enriched microdomains (PAG), a novel ubiquitously expressed transmembrane adaptor protein, binds the protein tyrosine kinase csk and is involved in regulation of T cell activation.
10781592 2000 Regulated association of microtubule-associated protein 2 (MAP2) with Src and Grb2: evidence for MAP2 as a scaffolding protein.
10781580 2000 GRB2 links signaling to actin assembly by enhancing interaction of neural Wiskott-Aldrich syndrome protein (N-WASp) with actin-related protein (ARP2/3) complex.
10748052 2000 Direct binding of the signaling adapter protein Grb2 to the activation loop tyrosines on the nerve growth factor receptor tyrosine kinase, TrkA.
10747847 2000 Identification and characterization of a new family of guanine nucleotide exchange factors for the ras-related GTPase Ral.
10734310 2000 Sustained recruitment of phospholipase C-gamma to Gab1 is required for HGF-induced branching tubulogenesis.
10706702 2000 Systematic analysis of the role of CD19 cytoplasmic tyrosines in enhancement of activation in Daudi human B cells: clustering of phospholipase C and Vav and of Grb2 and Sos with different CD19 tyrosines.
10660620 2000 PILRalpha, a novel immunoreceptor tyrosine-based inhibitory motif-bearing protein, recruits SHP-1 upon tyrosine phosphorylation and is paired with the truncated counterpart PILRbeta.
10660596 2000 Tyrosine dephosphorylation and deactivation of insulin receptor substrate-1 by protein-tyrosine phosphatase 1B. Possible facilitation by the formation of a ternary complex with the Grb2 adaptor protein.
10648629 2000 A novel positive feedback loop mediated by the docking protein Gab1 and phosphatidylinositol 3-kinase in epidermal growth factor receptor signaling.
10636929 2000 Biochemical interactions integrating Itk with the T cell receptor-initiated signaling cascade.
10602027 2000 Association of STAT1, STAT3 and STAT5 proteins with the IL-2 receptor involves different subdomains of the IL-2 receptor beta chain.
10567358 1999 The epsins define a family of proteins that interact with components of the clathrin coat and contain a new protein module.
10559276 1999 Tyrosine phosphorylation of caldesmon is required for binding to the Shc.Grb2 complex.
10556826 1999 Interaction of SLP adaptors with the SH2 domain of Tec family kinases.
10521483 1999 Identification of Tek/Tie2 binding partners. Binding to a multifunctional docking site mediates cell survival and migration.
10490839 1999 The transmembranal and cytoplasmic forms of protein tyrosine phosphatase epsilon physically associate with the adaptor molecule Grb2.
10488157 1999 Requirement of the Src homology 2 domain protein Shb for T cell receptor-dependent activation of the interleukin-2 gene nuclear factor for activation of T cells element in Jurkat T cells.
10477741 1999 Role of Src in the modulation of multiple adaptor proteins in FcalphaRI oxidant signaling.
10469124 1999 Evidence that phospholipase C-gamma2 interacts with SLP-76, Syk, Lyn, LAT and the Fc receptor gamma-chain after stimulation of the collagen receptor glycoprotein VI in human platelets.
10467411 1999 Evidence for SH3 domain directed binding and phosphorylation of Sam68 by Src.
10455176 1999 Tyrosine phosphorylation of tub and its association with Src homology 2 domain-containing proteins implicate tub in intracellular signaling by insulin.
10395476 1999 Structure-based design, synthesis, and X-ray crystallography of a high-affinity antagonist of the Grb2-SH2 domain containing an asparagine mimetic.
10386953 1999 Brain-derived neurotrophic factor stimulates interactions of Shp2 with phosphatidylinositol 3-kinase and Grb2 in cultured cerebral cortical neurons.
10377264 1999 Identification of Tyr-703 and Tyr-936 as the primary association sites for Grb2 and Grb7 in the c-Kit/stem cell factor receptor.
10359574 1999 Identification of Grb2 as a novel binding partner of tumor necrosis factor (TNF) receptor I.
10354709 1999 Signaling through focal adhesion kinase.
10339567 1999 CMS: an adapter molecule involved in cytoskeletal rearrangements.
10330178 1999 Ajuba, a novel LIM protein, interacts with Grb2, augments mitogen-activated protein kinase activity in fibroblasts, and promotes meiotic maturation of Xenopus oocytes in a Grb2- and Ras-dependent manner.
10329689 1999 Adaptor proteins Grb2 and Crk couple Pyk2 with activation of specific mitogen-activated protein kinase cascades.
10319320 1999 16K human prolactin inhibits vascular endothelial growth factor-induced activation of Ras in capillary endothelial cells.
10318918 1999 NS5A, a nonstructural protein of hepatitis C virus, binds growth factor receptor-bound protein 2 adaptor protein in a Src homology 3 domain/ligand-dependent manner and perturbs mitogenic signaling.
10229072 1999 Association of Nck with tyrosine-phosphorylated SLP-76 in activated T lymphocytes.
10224664 Wiskott-Aldrich syndrome protein, WASP.
10206341 1999 Characterization of interactions of Nck with Sos and dynamin.
10090780 1999 Structural and conformational requirements for high-affinity binding to the SH2 domain of Grb2(1).
10087612 1999 Waltzing with WASP.
10086340 1999 cbl-b inhibits epidermal growth factor receptor signaling.
10080542 1999 Flt3 signaling involves tyrosyl-phosphorylation of SHP-2 and SHIP and their association with Grb2 and Shc in Baf3/Flt3 cells.
10077576 1999 Characterization of Sam68-like mammalian proteins SLM-1 and SLM-2: SLM-1 is a Src substrate during mitosis.
10068651 1999 Gab-family adapter proteins act downstream of cytokine and growth factor receptors and T- and B-cell antigen receptors.
10051406 1999 The gene structure of the human growth factor bound protein GRB2.
10026169 1999 Identification of Grb4/Nckbeta, a src homology 2 and 3 domain-containing adapter protein having similar binding and biological properties to Nck.
10022833 1999 Socs1 binds to multiple signalling proteins and suppresses steel factor-dependent proliferation.
10022120 1999 Tyrosine phosphorylation and complex formation of Cbl-b upon T cell receptor stimulation.
9927207 1999 Role of tyrosine residues and protein interaction domains of SHC adaptor in VEGF receptor 3 signaling.
9891069 1999 Interaction of hematopoietic progenitor kinase 1 with adapter proteins Crk and CrkL leads to synergistic activation of c-Jun N-terminal kinase.
9891051 1999 Biological effects of c-Mer receptor tyrosine kinase in hematopoietic cells depend on the Grb2 binding site in the receptor and activation of NF-kappaB.
9856458 1998 Identification and characterization of novel substrates of Trk receptors in developing neurons.
9852124 1998 Insulin receptor substrate 2 and Shc play different roles in insulin-like growth factor I signaling.
9846481 1998 Adaptor function for the Syk kinases-interacting protein 3BP2 in IL-2 gene activation.
9843378 1998 SH3 binding domains in the dopamine D4 receptor.
9830057 1998 Insulin stimulates sequestration of beta-adrenergic receptors and enhanced association of beta-adrenergic receptors with Grb2 via tyrosine 350.
9824671 1998 Direct binding of Shc, Grb2, SHP-2 and p40 to the murine granulocyte colony-stimulating factor receptor.
9788432 1998 The germinal center kinase (GCK)-related protein kinases HPK1 and KHS are candidates for highly selective signal transducers of Crk family adapter proteins.
9733714 1998 Grb2 interaction with MEK-kinase 1 is involved in regulation of Jun-kinase activities in response to epidermal growth factor.
9722576 1998 Identification of vascular endothelial growth factor receptor-1 tyrosine phosphorylation sites and binding of SH2 domain-containing molecules.
9716598 1998 SLP-76-Cbl-Grb2-Shc interactions in FcgammaRI signaling.
9705962 1998 SLP-65: a new signaling component in B lymphocytes which requires expression of the antigen receptor for phosphorylation.
9697839 1998 BLNK: a central linker protein in B cell activation.
9694876 1998 Grb2 forms an inducible protein complex with CD28 through a Src homology 3 domain-proline interaction.
9690470 1998 The structural basis of the activation of Ras by Sos.
9670936 1998 Growth factor receptor-bound protein 2 (Grb2) association with hemopoietic specific protein 1: linkage between Lck and Grb2.
9668219 1998 Interaction between the nicotinic acetylcholine receptor and Grb2. Implications for signaling at the neuromuscular junction.
9660791 1998 A new tyrosine-phosphorylated 97-kDa adaptor protein mediates interleukin-2-induced association of SHP-2 with p85-phosphatidylinositol 3-kinase in human T lymphocytes.
9660480 1998 Signaling by HGF and KGF in corneal epithelial cells: Ras/MAP kinase and Jak-STAT pathways.
9642078 1998 Structural basis for the high affinity of amino-aromatic SH2 phosphopeptide ligands.
9632781 1998 Binding of Shp2 tyrosine phosphatase to FRS2 is essential for fibroblast growth factor-induced PC12 cell differentiation.
9632734 1998 Activation of extracellular signal-regulated kinase 2 by a novel Abl-binding protein, ST5.
9632636 1998 Grb10 identified as a potential regulator of growth hormone (GH) signaling by cloning of GH receptor target proteins.
9590294 1998 Human deltex is a conserved regulator of Notch signalling.
9569023 1998 Disabled-2 (Dab2) is an SH3 domain-binding partner of Grb2.
9553137 1998 Characterization of insulin receptor substrate 4 in human embryonic kidney 293 cells.
9544989 1998 Shc phosphotyrosine-binding domain dominantly interacts with epidermal growth factor receptors and mediates Ras activation in intact cells.
9516488 1998 Grb2 and its apoptotic isoform Grb3-3 associate with heterogeneous nuclear ribonucleoprotein C, and these interactions are modulated by poly(U) RNA.
9507006 1998 Identification of sirm, a novel insulin-regulated SH3 binding protein that associates with Grb-2 and FYN.
9489702 1998 LAT: the ZAP-70 tyrosine kinase substrate that links T cell receptor to cellular activation.
9484780 1998 Stimulation through the T cell receptor leads to interactions between SHB and several signaling proteins.
9480847 1998 Novel recruitment of Shc, Grb2, and Sos by fibroblast growth factor receptor-1 in v-Src-transformed cells.
9447984 1998 Regulation of Sos activity by intramolecular interactions.
9422736 1998 Identification and characterization of a novel protein interacting with Ral-binding protein 1, a putative effector protein of Ral.
9395447 1997 An Eps homology (EH) domain protein that binds to the Ral-GTPase target, RalBP1.
9393871 1997 The multiple endocrine neoplasia type 2B point mutation switches the specificity of the Ret tyrosine kinase towards cellular substrates that are susceptible to interact with Crk and Nck.
9388224 1997 Synaptojanin 2, a novel synaptojanin isoform with a distinct targeting domain and expression pattern.
9380408 1997 Identification of a second Grb2 binding site in the v-Fms tyrosine kinase.
9368064 1997 Growth factors stimulate tyrosine dephosphorylation of p75 and its dissociation from the SH2 domain of Grb2.
9356464 1997 Grb2-associated binder-1 mediates phosphatidylinositol 3-kinase activation and the promotion of cell survival by nerve growth factor.
9346925 1997 SH2/SH3 adaptor proteins can link tyrosine kinases to a Ste20-related protein kinase, HPK1.
9344857 1997 A novel ligand for an SH3 domain of the adaptor protein Nck bears an SH2 domain and nuclear signaling motifs.
9341187 1997 Identification of two tyrosine phosphoproteins, pp70 and pp68, which interact with phospholipase Cgamma, Grb2, and Vav after B cell antigen receptor activation.
9307968 1997 Wiskott-Aldrich syndrome protein is associated with the adapter protein Grb2 and the epidermal growth factor receptor in living cells.
9299436 1997 Adenosine deaminase is a specific partner for the Grb2 isoform Grb3-3.
9295052 1997 Ligation of the T cell antigen receptor induces tyrosine phosphorylation of p105CasL, a member of the p130Cas-related docking protein family, and its subsequent binding to the Src homology 2 domain of c-Crk.
9281317 1997 A new function for phospholipase C-gamma1: coupling to the adaptor protein GRB2.
9254595 1997 Thermodynamic and structural analysis of phosphotyrosine polypeptide binding to Grb2-SH2.
9233773 1997 Cloning and characterization of APS, an adaptor molecule containing PH and SH2 domains that is tyrosine phosphorylated upon B-cell receptor stimulation.
9182757 1997 A lipid-anchored Grb2-binding protein that links FGF-receptor activation to the Ras/MAPK signaling pathway.
9178913 1997 Bcr phosphorylated on tyrosine 177 binds Grb2.
9178909 1997 CSF-1 stimulation induces the formation of a multiprotein complex including CSF-1 receptor, c-Cbl, PI 3-kinase, Crk-II and Grb2.
9178760 1997 Intracellular signaling of the Ufo/Axl receptor tyrosine kinase is mediated mainly by a multi-substrate docking-site.
9175774 1997 An alternative to phosphotyrosine-containing motifs for binding to an SH2 domain.
9174058 1997 Tyrosine phosphorylation of p120cbl in BCR/abl transformed hematopoietic cells mediates enhanced association with phosphatidylinositol 3-kinase.
9171350 1997 The coupling of alpha6beta4 integrin to Ras-MAP kinase pathways mediated by Shc controls keratinocyte proliferation.
9148935 1997 Focal adhesion kinase overexpression enhances ras-dependent integrin signaling to ERK2/mitogen-activated protein kinase through interactions with and activation of c-Src.
9135065 1997 Coupling of the murine protein tyrosine phosphatase PEST to the epidermal growth factor (EGF) receptor through a Src homology 3 (SH3) domain-mediated association with Grb2.
9108392 1997 Purification and molecular cloning of SH2- and SH3-containing inositol polyphosphate-5-phosphatase, which is involved in the signaling pathway of granulocyte-macrophage colony-stimulating factor, erythropoietin, and Bcr-Abl.
9079622 1997 SH3 domain-dependent association of huntingtin with epidermal growth factor receptor signaling complexes.
9062191 1997 A family of proteins that inhibit signalling through tyrosine kinase receptors.
9050991 1997 The RIalpha subunit of protein kinase A (PKA) binds to Grb2 and allows PKA interaction with the activated EGF-receptor.
9045692 1997 Signal transduction pathway of human fibroblast growth factor receptor 3. Identification of a novel 66-kDa phosphoprotein.
9045636 1997 Interaction between Sam68 and Src family tyrosine kinases, Fyn and Lck, in T cell receptor signaling.
9038219 1997 Signaling inositol polyphosphate-5-phosphatase. Characterization of activity and effect of GRB2 association.
9032261 1997 Lck regulates Vav activation of members of the Rho family of GTPases.
9020117 1997 Subsets of epidermal growth factor receptors during activation and endocytosis.
9019171 1995 Involvement of stress-activated protein kinase in the cellular response to 1-beta-D-arabinofuranosylcytosine and other DNA-damaging agents.
9016807 1997 Phosphorylation of growth factor receptor binding protein-2 by pp60c-src tyrosine kinase.
9013873 1997 Vav is associated with signal transducing molecules gp130, Grb2 and Erk2, and is tyrosine phosphorylated in response to interleukin-6.
9009162 1997 Multiple Grb2-protein complexes in human cancer cells.
8995445 1997 SLP-76 is a substrate of the high affinity IgE receptor-stimulated protein tyrosine kinases in rat basophilic leukemia cells.
8995379 1997 The role of a lymphoid-restricted, Grb2-like SH3-SH2-SH3 protein in T cell receptor signaling.
8994038 1997 Linkage of G protein-coupled receptors to the MAPK signaling pathway through PI 3-kinase gamma.
8986819 1996 L-selectin activates the Ras pathway via the tyrosine kinase p56lck.
8959326 1996 Multiple in vivo phosphorylated tyrosine phosphatase SHP-2 engages binding to Grb2 via tyrosine 584.
8955163 1996 Identification of a novel 135-kDa Grb2-binding protein in osteoclasts.
8955135 1996 Co-expression with BCR induces activation of the FES tyrosine kinase and phosphorylation of specific N-terminal BCR tyrosine residues.
8943348 1996 Phosphorylation of tyrosine 720 in the platelet-derived growth factor alpha receptor is required for binding of Grb2 and SHP-2 but not for activation of Ras or cell proliferation.
8940013 1996 The Grb2-mSos1 complex binds phosphopeptides with higher affinity than Grb2.
8939605 1996 The Shc adaptor protein is highly phosphorylated at conserved, twin tyrosine residues (Y239/240) that mediate protein-protein interactions.
8918464 1996 STK/RON receptor tyrosine kinase mediates both apoptotic and growth signals via the multifunctional docking site conserved among the HGF receptor family.
8892607 1996 Evidence that the Wiskott-Aldrich syndrome protein may be involved in lymphoid cell signaling pathways.
8887653 1996 The phosphotyrosine interaction domains of X11 and FE65 bind to distinct sites on the YENPTY motif of amyloid precursor protein.
8816480 1996 Identification of the mitogen-activated protein kinase phosphorylation sites on human Sos1 that regulate interaction with Grb2.
8816475 1996 Evidence for in vivo phosphorylation of the Grb2 SH2-domain binding site on focal adhesion kinase by Src-family protein-tyrosine kinases.
8810325 1996 Interactions between Src homology (SH) 2/SH3 adapter proteins and the guanylnucleotide exchange factor SOS are differentially regulated by insulin and epidermal growth factor.
8798570 1996 Ligand activation of ELK receptor tyrosine kinase promotes its association with Grb10 and Grb2 in vascular endothelial cells.
8794768 1996 Nuclear magnetic resonance solution structure of the growth factor receptor-bound protein 2 Src homology 2 domain.
8780727 1996 Suc1-associated neurotrophic factor target (SNT) protein is a major FGF-stimulated tyrosine phosphorylated 90-kDa protein which binds to the SH2 domain of GRB2.
8723348 1996 Multiple forms of an inositol polyphosphate 5-phosphatase form signaling complexes with Shc and Grb2.
8702859 1996 Epidermal growth factor induces coupling of protein-tyrosine phosphatase 1D to GRB2 via the COOH-terminal SH3 domain of GRB2.
8700507 1996 Networks of interaction of p120cbl and p130cas with Crk and Grb2 adaptor proteins.
8695800 1996 Characterization of Grb2-binding proteins in human platelets activated by Fc gamma RIIA cross-linking.
8670803 1996 Tight association of GRB2 with receptor protein-tyrosine phosphatase alpha is mediated by the SH2 and C-terminal SH3 domains.
8670205 1996 Tyrosine phosphorylation of a 94-kDa protein associated with GRB2/ASH is implicated in the signal transduction of hematopoietic survival factors.
8663276 1996 ATP and SH3 binding sites in the protein kinase of the large subunit of herpes simplex virus type 2 of ribonucleotide reductase (ICP10).
8663178 1996 Rapid identification of phosphopeptide ligands for SH2 domains. Screening of peptide libraries by fluorescence-activated bead sorting.
8662998 1996 Tyrosine phosphorylation of Cbl upon epidermal growth factor (EGF) stimulation and its association with EGF receptor and downstream signaling proteins.
8662907 1996 Interaction between the amino-terminal SH3 domain of CRK and its natural target proteins.
8662889 1996 Specific uncoupling of GRB2 from the Met receptor. Differential effects on transformation and motility.
8662748 1996 Interaction with the phosphotyrosine binding domain/phosphotyrosine interacting domain of SHC is required for the transforming activity of the FLT4/VEGFR3 receptor tyrosine kinase.
8649391 1996 Tyrosine phosphorylation of Grb2-associated proteins correlates with phospholipase C gamma 1 activation in T cells.
8649368 1996 Introduction of p130cas signaling complex formation upon integrin-mediated cell adhesion: a role for Src family kinases.
8647288 1996 Tyrosine phosphorylation of ACK in response to temperature shift-down, hyperosmotic shock, and epidermal growth factor stimulation.
8633037 1996 Characterization of the transforming activity of p80, a hyperphosphorylated protein in a Ki-1 lymphoma cell line with chromosomal translocation t(2;5).
8631894 1996 Outside-in integrin signal transduction. Alpha IIb beta 3-(GP IIb IIIa) tyrosine phosphorylation induced by platelet aggregation.
8630373 1996 Tryptophan 650 of human granulocyte colony-stimulating factor (G-CSF) receptor, implicated in the activation of JAK2, is also required for G-CSF-mediated activation of signaling complexes of the p21ras route.
8621719 1996 p120cbl is a major substrate of tyrosine phosphorylation upon B cell antigen receptor stimulation and interacts in vivo with Fyn and Syk tyrosine kinases, Grb2 and Shc adaptors, and the p85 subunit of phosphatidylinositol 3-kinase.
8621483 1996 Sos, Vav, and C3G participate in B cell receptor-induced signaling pathways and differentially associate with Shc-Grb2, Crk, and Crk-L adaptors.
8585965 1996 Novel adapter proteins that link the human GM-CSF receptor to the phosphatidylino-sitol 3-kinase and Shc/Grb2/ras signaling pathways.
8585605 1995 Competitive binding assay of src homology domain 3 interactions between 5-lipoxygenase and growth factor receptor binding protein 2.
8576157 1996 Signal transduction by CD28 costimulatory receptor on T cells. B7-1 and B7-2 regulation of tyrosine kinase adaptor molecules.
8570203 1996 Association of CD45 with Lck and components of the Ras signalling pathway in pervanadate-treated mouse T-cell lines.
8547634 1996 Specific involvement of tyrosine 764 of human granulocyte colony-stimulating factor receptor in signal transduction mediated by p145/Shc/GRB2 or p90/GRB2 complexes.
8536716 1995 Involvement of Janus kinases in the insulin signaling pathway.
8493579 1993 Human Sos1: a guanine nucleotide exchange factor for Ras that binds to GRB2.
8491186 1993 The SH2/SH3 domain-containing protein GRB2 interacts with tyrosine-phosphorylated IRS1 and Shc: implications for insulin control of ras signalling.
8479541 1993 Guanine-nucleotide-releasing factor hSos1 binds to Grb2 and links receptor tyrosine kinases to Ras signalling.
8388384 1993 Insulin stimulates association of insulin receptor substrate-1 with the protein abundant Src homology/growth factor receptor-bound protein 2.
8262059 1993 Mutation of Tyr697, a GRB2-binding site, and Tyr721, a PI 3-kinase binding site, abrogates signal transduction by the murine CSF-1 receptor expressed in Rat-2 fibroblasts.
8253073 1993 Ash/Grb-2, a SH2/SH3-containing protein, couples to signaling for mitogenesis and cytoskeletal reorganization by EGF and PDGF.
8188688 1994 SH3 domains of the adapter molecule Grb2 complex with two proteins in T cells: the guanine nucleotide exchange protein Sos and a 75-kDa protein that is a substrate for T cell antigen receptor-activated tyrosine kinases.
8178156 1994 Cloning of a Grb2 isoform with apoptotic properties.
8119878 1994 Association of Ash/Grb-2 with dynamin through the Src homology 3 domain.
8112292 1994 Bcr-Abl oncoproteins bind directly to activators of the Ras signalling pathway.
8063801 1994 In vivo association of Grb2 with pp116, a substrate of the T cell antigen receptor-activated protein tyrosine kinase.
8041791 1994 Protein-tyrosine-phosphatase SHPTP2 couples platelet-derived growth factor receptor beta to Ras.
8022809 1994 Interaction of Grb2 via its Src homology 3 domains with synaptic proteins including synapsin I.
7997267 1994 Integrin-mediated signal transduction linked to Ras pathway by GRB2 binding to focal adhesion kinase.
7982917 1994 p145, a major Grb2-binding protein in brain, is co-localized with dynamin in nerve terminals where it undergoes activity-dependent dephosphorylation.
7970715 1994 Signalling properties of FLT4, a proteolytically processed receptor tyrosine kinase related to two VEGF receptors.
7935391 1994 Tyr-716 in the platelet-derived growth factor beta-receptor kinase insert is involved in GRB2 binding and Ras activation.
7929073 1994 5-Lipoxygenase contains a functional Src homology 3-binding motif that interacts with the Src homology 3 domain of Grb2 and cytoskeletal proteins.
7881903 1994 Solution structure and ligand-binding site of the carboxy-terminal SH3 domain of GRB2.
7809090 1994 Binding of Vav to Grb2 through dimerization of Src homology 3 domains.
7806216 1994 Mapping GRB2, a signal transduction gene in the human and the mouse.
7806213 1994 Chromosome locations of genes encoding human signal transduction adapter proteins, Nck (NCK), Shc (SHC1), and Grb2 (GRB2).
7799925 1995 Association of p62, a multifunctional SH2- and SH3-domain-binding protein, with src family tyrosine kinases, Grb2, and phospholipase C gamma-1.
7798267 1994 The signaling pathway coupling epidermal growth factor receptors to activation of p21ras.
7773779 1994 NMR structure of the N-terminal SH3 domain of GRB2 and its complex with a proline-rich peptide from Sos.
7759531 1995 Direct association of Grb2 with the p85 subunit of phosphatidylinositol 3-kinase.
7744812 1995 SH3 domain-mediated interaction of dystroglycan and Grb2.
7739560 1995 Insulin-stimulated disassociation of the SOS-Grb2 complex.
7737969 1995 Monocyte colony-stimulating factor stimulates binding of phosphatidylinositol 3-kinase to Grb2.Sos complexes in human monocytes.
7737275 1995 T cell antigen CD28 binds to the GRB-2/SOS complex, regulators of p21ras.
7716522 1995 Crystal structure of the mammalian Grb2 adaptor.
7706237 1995 Molecular cloning of SLP-76, a 76-kDa tyrosine phosphoprotein associated with Grb2 in T cells.
7675451 1995 Mutation at tyrosine residue 1337 abrogates ligand-dependent transforming capacity of the FLT4 receptor.
7675449 1995 Constitutive phosphorylation of Shc proteins in human tumors.
7664271 1995 Association of the DF3/MUC1 breast cancer antigen with Grb2 and the Sos/Ras exchange protein.
7642581 1995 The SH3 domain-binding T cell tyrosyl phosphoprotein p120. Demonstration of its identity with the c-cbl protooncogene product and in vivo complexes with Fyn, Grb2, and phosphatidylinositol 3-kinase.
7642542 1995 Ionizing radiation stimulates a Grb2-mediated association of the stress-activated protein kinase with phosphatidylinositol 3-kinase.
7629168 1995 Ligation of the T-cell antigen receptor (TCR) induces association of hSos1, ZAP-70, phospholipase C-gamma 1, and other phosphoproteins with Grb2 and the zeta-chain of the TCR.
7629138 1995 Differential interactions of human Sos1 and Sos2 with Grb2.
7559579 1995 4PS/insulin receptor substrate (IRS)-2 is the alternative substrate of the insulin receptor in IRS-1-deficient mice.
7556090 1995 Signal transduction by the alpha 6 beta 4 integrin: distinct beta 4 subunit sites mediate recruitment of Shc/Grb2 and association with the cytoskeleton of hemidesmosomes.
7544353 1995 T cell activation-dependent association between the p85 subunit of the phosphatidylinositol 3-kinase and Grb2/phospholipase C-gamma 1-binding phosphotyrosyl protein pp36/38.
7537265 1995 Functional interaction between c-Src and its mitotic target, Sam 68.
7535773 1995 Growth hormone-promoted tyrosyl phosphorylation of SHC proteins and SHC association with Grb2.
7534299 1995 Involvement of SH2-containing phosphotyrosine phosphatase Syp in erythropoietin receptor signal transduction pathways.
7527391 1994 Independent binding of peptide ligands to the SH2 and SH3 domains of Grb2.
7527043 1994 Grb2/Ash binds directly to tyrosines 1068 and 1086 and indirectly to tyrosine 1148 of activated human epidermal growth factor receptors in intact cells.
7524086 1994 Stimulation of glycogen synthesis by insulin in human erythroleukemia cells requires the synthesis of glycosyl-phosphatidylinositol.
7523381 1994 The ubiquitously expressed Syp phosphatase interacts with c-kit and Grb2 in hematopoietic cells.
7522233 1994 Interleukin (IL)-3 and granulocyte/macrophage colony-stimulating factor, but not IL-4, induce tyrosine phosphorylation, activation, and association of SHPTP2 with Grb2 and phosphatidylinositol 3'-kinase.
7518772 1994 Phosphorylation of receptor protein-tyrosine phosphatase alpha on Tyr789, a binding site for the SH3-SH2-SH3 adaptor protein GRB-2 in vivo.
7518560 1994 Hierarchy of binding sites for Grb2 and Shc on the epidermal growth factor receptor.
7511210 1994 Specific motifs recognized by the SH2 domains of Csk, 3BP2, fps/fes, GRB-2, HCP, SHC, Syk, and Vav.
7510700 1994 A complex of Grb2 adaptor protein, Sos exchange factor, and a 36-kDa membrane-bound tyrosine phosphoprotein is implicated in ras activation in T cells.
7504175 1993 Pleiotropic insulin signals are engaged by multisite phosphorylation of IRS-1.
7500025 1995 Oncostatin M induces association of Grb2 with Janus kinase JAK2 in multiple myeloma cells.
7488107 1995 Cloning of a cDNA encoding a 190-kDa insulin receptor substrate-1-like protein of simian COS cells.
7488076 1995 Macrophage-stimulating protein activates Ras by both activation and translocation of SOS nucleotide exchange factor.
7486658 1995 A 115 kDa tyrosine phosphorylated protein associates with Grb-2 in activated Jurkat cells.
7478529 1995 GRB2 and SH-PTP2: potentially important endothelial signaling molecules downstream of the TEK/TIE2 receptor tyrosine kinase.
1384039 1992 Cloning of ASH, a ubiquitous protein composed of one Src homology region (SH) 2 and two SH3 domains, from human and rat cDNA libraries.
1322798 1992 The SH2 and SH3 domain-containing protein GRB2 links receptor tyrosine kinases to ras signaling.
917890 [A case of adrenal adenoma diagnosed by means of adrenal phlebography (author's transl)].