Property Summary

NCBI Gene PubMed Count 42
PubMed Score 41.44
PubTator Score 35.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
gastric cancer 1.500 3.4e-03
pancreatic cancer 1.800 1.4e-04
malignant mesothelioma -3.700 1.5e-08
astrocytic glioma -2.300 8.1e-03
ependymoma -2.100 3.8e-02
oligodendroglioma -2.600 5.3e-03
psoriasis -3.000 1.7e-04
osteosarcoma -1.909 1.7e-02
medulloblastoma -2.900 4.8e-05
cystic fibrosis 1.769 1.2e-04
atypical teratoid / rhabdoid tumor -2.000 4.0e-02
glioblastoma -2.100 1.4e-02
medulloblastoma, large-cell -2.700 9.8e-03
pancreatic ductal adenocarcinoma liver m... -1.534 2.0e-02
intraductal papillary-mucinous adenoma (... -4.100 2.0e-06
intraductal papillary-mucinous carcinoma... -3.500 8.2e-04
intraductal papillary-mucinous neoplasm ... -2.800 7.1e-03
lung cancer 2.700 8.0e-05
pilocytic astrocytoma -1.400 2.3e-02
pancreatic carcinoma 1.800 1.4e-04
subependymal giant cell astrocytoma 2.985 2.5e-03
lung adenocarcinoma 1.382 2.3e-02

Gene RIF (17)

PMID Text
24535599 Phosphorylation of Grb14 BPS domain by GSK-3 correlates with complex forming of Grb14 and insulin receptor.
24273167 Modulation of mouse rod photoreceptor responses by Grb14 protein.
23670221 Genes within recently identified loci associated with waist-hip ratio (WHR) exhibit fat depot-specific mRNA expression, which correlates with obesity-related traits. Adipose tissue (AT) mRNA expression of 6 genes (TBX15/WARS2, STAB1, PIGC, ZNRF3, GRB14
23457408 ANKRD55 rs459193 and GRB14 rs13389219 associate with insulin resistance.
23190452 Studies indicate that insulin receptor (IR) and IGF Type 1 Receptor (IGFR) have been identified as important partners of Grb10/14 and SH2B1/B2 adaptors.
22948154 Grb14 is the first negative regulator of CEACAM3-initiated bacterial phagocytosis and might help to focus granulocyte responses to the subcellular sites of pathogen-host cell contact
22158039 A new role for Grb14 in finely tuning receptor signaling and modulating thyroid cancer progression.
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20932831 Grb14 was recruited to FGFR1 into a trimeric complex containing also phospholipase C gamma
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19648926 Results illuminate the membrane-recruitment mechanisms of Grb7, Grb10 and Grb14.
19359342 Grb14 regulates insulin action at two levels, through insulin receptors binding and by interfering with downstream pathways.
19268276 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16849634 GRB14 is a weight-loss-responsive gene in skeletal muscle. Its observed transcriptional modulation may improve insulin signaling, with weight loss.
16582879 Grb14 may regulate signalling through the insulin receptor by controlling its tyrosine dephosphorylation in a site-specific manner.
15372466 regulation of Grb14 expression levels in response to hormonal stimuli, and are consistent with its role as a repressor of insulin signaling where it is induced as a negative feedback mechanism.
15210700 serves as an adaptor protein to recruit 3-phosphoinositede-dependent kinase-1 to activated insulin receptor, thus promoting Akt phosphorylation and transduction of the insulin signal

AA Sequence

MTTSLQDGQSAASRAAARDSPLAAQVCGAAQGRGDAHDLAPAPWLHARALLPLPDGTRGCAADRRKKKDL      1 - 70
DVPEMPSIPNPFPELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSRALDVPSDITARDVCQLLILK     71 - 140
NHYIDDHSWTLFEHLPHIGVERTIEDHELVIEVLSNWGIEEENKLYFRKNYAKYEFFKNPMYFFPEHMVS    141 - 210
FATETNGEISPTQILQMFLSSSTYPEIHGFLHAKEQGKKSWKKIYFFLRRSGLYFSTKGTSKEPRHLQFF    211 - 280
SEFGNSDIYVSLAGKKKHGAPTNYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNY    281 - 350
MHPYQGRSGCSSQSISPMRSISENSLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLGTHGSP    351 - 420
TASSQSSATNMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMSHGQKIKHFQI    421 - 490
IPVEDDGEMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARIAL                        491 - 540
//

Text Mined References (48)

PMID Year Title
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
24535599 2014 Phosphorylation of Grb14 BPS domain by GSK-3 correlates with complex forming of Grb14 and insulin receptor.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24455749 2013 Identifying candidate genes for Type 2 Diabetes Mellitus and obesity through gene expression profiling in multiple tissues or cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24273167 2014 Modulation of mouse rod photoreceptor responses by Grb14 protein.
23827965 2013 Pleiotropic effects of obesity-susceptibility loci on metabolic traits: a meta-analysis of up to 37,874 individuals.
23754948 2013 Sex-stratified genome-wide association studies including 270,000 individuals show sexual dimorphism in genetic loci for anthropometric traits.
23670221 2014 Fat depot-specific mRNA expression of novel loci associated with waist-hip ratio.
23457408 2013 Type 2 diabetes risk alleles near BCAR1 and in ANK1 associate with decreased ?-cell function whereas risk alleles near ANKRD55 and GRB14 associate with decreased insulin sensitivity in the Danish Inter99 cohort.
23190452 2013 Regulation of insulin and type 1 insulin-like growth factor signaling and action by the Grb10/14 and SH2B1/B2 adaptor proteins.
23043714 2012 Genome-wide association studies-derived susceptibility loci in type 2 diabetes: confirmation in a Chinese population.
22948154 2012 Grb14 is a negative regulator of CEACAM3-mediated phagocytosis of pathogenic bacteria.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22158039 2012 The insulin resistance Grb14 adaptor protein promotes thyroid cancer ret signaling and progression.
21874001 2011 Genome-wide association study in individuals of South Asian ancestry identifies six new type 2 diabetes susceptibility loci.
21572416 2011 Meta-analysis of genome-wide association studies identifies common variants associated with blood pressure variation in east Asians.
21220648 2011 Resequencing of 29 candidate genes in patients with familial and sporadic amyotrophic lateral sclerosis.
20973951 2010 Tyrosine phosphorylation of Grb14 by Tie2.
20935629 2010 Meta-analysis identifies 13 new loci associated with waist-hip ratio and reveals sexual dimorphism in the genetic basis of fat distribution.
20932831 2010 Grb14 inhibits FGF receptor signaling through the regulation of PLC? recruitment and activation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
19648926 2009 Structural and functional studies of the Ras-associating and pleckstrin-homology domains of Grb10 and Grb14.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19359342 2009 Molecular determinants of Grb14-mediated inhibition of insulin signaling.
19268276 2009 Genome-wide association study of smoking initiation and current smoking.
16849634 2006 GRB14, GPD1, and GDF8 as potential network collaborators in weight loss-induced improvements in insulin action in human skeletal muscle.
16582879 2006 Interaction with Grb14 results in site-specific regulation of tyrosine phosphorylation of the insulin receptor.
16246733 2005 Structural basis for inhibition of the insulin receptor by the adaptor protein Grb14.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372466 2005 Hormonal regulation of the Grb14 signal modulator and its role in cell cycle progression of MCF-7 human breast cancer cells.
15322292 2004 Solution structure of the human Grb14-SH2 domain and comparison with the structures of the human Grb7-SH2/erbB2 peptide complex and human Grb10-SH2 domain.
15210700 2004 The adaptor protein Grb14 regulates the localization of 3-phosphoinositide-dependent kinase-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12242277 2002 The adapter protein ZIP binds Grb14 and regulates its inhibitory action on insulin signaling by recruiting protein kinase Czeta.
11726652 2002 Inhibition of insulin receptor catalytic activity by the molecular adapter Grb14.
11607834 2001 The Grb7 family proteins: structure, interactions with other signaling molecules and potential cellular functions.
11278563 2001 Identification of a novel human tankyrase through its interaction with the adaptor protein Grb14.
11235915 2001 Human growth factor receptor bound 14 binds the activated insulin receptor and alters the insulin-stimulated tyrosine phosphorylation levels of multiple proteins.
10713090 2000 Association of fibroblast growth factor receptor 1 with the adaptor protein Grb14. Characterization of a new receptor binding partner.
10521483 1999 Identification of Tek/Tie2 binding partners. Binding to a multifunctional docking site mediates cell survival and migration.
9748281 1998 Identification of the rat adapter Grb14 as an inhibitor of insulin actions.
9360986 1997 Cloning, chromosome localization, expression, and characterization of an Src homology 2 and pleckstrin homology domain-containing insulin receptor binding protein hGrb10gamma.
8812444 1996 Assignment of the human GRB14 gene to chromosome 2q22-q24 by fluorescence in situ hybridization.
8647858 1996 Cloning and characterization of GRB14, a novel member of the GRB7 gene family.