Property Summary

NCBI Gene PubMed Count 13
PubMed Score 31.78
PubTator Score 14.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2755 1.7e-11
osteosarcoma 7766 2.3e-06
tuberculosis and treatment for 6 months 399 2.0e-05
Disease Target Count Z-score Confidence
Hypospadias 48 3.326 1.7
Choledocholithiasis 11 3.116 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
lung carcinoma -1.100 1.7e-11
osteosarcoma -1.682 2.3e-06
tuberculosis and treatment for 6 months -1.100 2.0e-05

Synonym

Accession Q13588
Symbols

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (5)

AA Sequence

MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGVEGFIPKNYIRVKPHPWYSGRISRQLA      1 - 70
EEILMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLREASGKYFLWEEKFNSLNELVDFYRTTTI     71 - 140
AKKRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPDPHWWRGRSCGRVGFFPRS    141 - 210
YVQPVHL                                                                   211 - 217
//

Text Mined References (14)

PMID Year Title