Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -1.900 2.5e-06
group 3 medulloblastoma -2.700 2.6e-04
medulloblastoma, large-cell -3.600 1.5e-06
primitive neuroectodermal tumor -1.300 1.5e-02
colon cancer -1.800 2.6e-04
lung cancer -1.800 4.9e-04
ulcerative colitis -1.600 5.3e-06
interstitial cystitis -2.100 8.7e-05
lung adenocarcinoma 1.900 7.9e-03
nasopharyngeal carcinoma -1.400 6.8e-03
Endometriosis -1.112 2.1e-02
Breast cancer -2.100 7.2e-10
lung carcinoma 1.100 5.1e-08
spina bifida -2.578 4.9e-02
gastric carcinoma -1.400 3.7e-02
ovarian cancer -2.300 4.6e-05
facioscapulohumeral dystrophy 2.200 1.8e-05

AA Sequence

MEGAPTVRQVMNEGDSSLATDLQEDVEENPSPTVEENNVVVKKQGPNLHNWSGDWSFWISSSTYKDRNEE      1 - 70
YRRQFTHLPDTERLIADYACALQRDILLQGRLYLSENWLCFYSNIFRWETTISIALKNITFMTKEKTARL     71 - 140
IPNAIQIVTESEKFFFTSFGARDRSYLSIFRLWQNVLLDKSLTRQEFWQLLQQNYGTELGLNAEEMENLS    141 - 210
LSIEDVQPRSPGRSSLDDSGERDEKLSKSISFTSESISRVSETESFDGNSSKGGLGKEESQNEKQTKKSL    211 - 280
LPTLEKKLTRVPSKSLDLNKNEYLSLDKSSTSDSVDEENVPEKDLHGRLFINRIFHISADRMFELLFTSS    281 - 350
RFMQKFASSRNIIDVVSTPWTAELGGDQLRTMTYTIVLNSPLTGKCTAATEKQTLYKESREARFYLVDSE    351 - 420
VLTHDVPYHDYFYTVNRYCIIRSSKQKCRLRVSTDLKYRKQPWGLVKSLIEKNSWSSLEDYFKQLESDLL    421 - 490
IEESVLNQAIEDPGKLTGLRRRRRTFNRTAETVPKLSSQHSSGDVGLGAKGDITGKKKEMENYNVTLIVV    491 - 560
MSIFVLLLVLLNVTLFLKLSKIEHAAQSFYRLRLQEEKSLNLASDMVSRAETIQKNKDQAHRLKGVLRDS    561 - 630
IVMLEQLKSSLIMLQKTFDLLNKNKTGMAVES                                          631 - 662
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.