Property Summary

NCBI Gene PubMed Count 23
PubMed Score 27.28
PubTator Score 13.45

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96SL4 O95337 Q5T501 GPx-7
Symbols GPX6
CL683
GPx-7
NPGPx
GSHPx-7

Gene

PANTHER Protein Class (2)

PDB

2P31  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (18)

PMID Text
26708178 use GPX4 and GPX7 as possible markers for improving HCC diagnosis/prognosis.
25586538 SNPs most associated with Chemotherapy-induced peripheral neuropathy were in ATP-binding cassette sub-family C member 4 (ABCC4) gene.
24692067 Loss of glutathione peroxidase 7 promotes TNF-alpha-induced NF-kappaB activation in Barrett's carcinogenesis.
23919619 GPx7 promotes oxidative protein folding, directly utilizing Ero1alpha-generated hydrogen peroxide in the early secretory compartment.
23828861 NPGPx protects against fat accumulation in mice and human via modulating ROS
23580780 tumour suppressor functions in esophageal adenocarcinomas and silenced by location-specific promoter DNA methylation
23454490 GPx7 is an unusual CysGPx catalyzing the peroxidatic cycle by a one Cys mechanism in which GSH and PDI are alternative substrates.
23123197 NPGPx is essential for releasing excessive ER stress by enhancing GRP78 chaperone activity to maintain physiological homeostasis.
21215271 GPx7 labeled as secreted glutathione peroxidase, is actually endoplasmic reticulum-resident protein disulfide isomerase peroxidase
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20200426 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15910762 HIV-1 Tat causes a greater than 50% decrease in intracellular reduced glutathione (GSH), leading to the extracellular appearance of acidic FGF-1, an effect that is partially mediated through modulation of GSH biosynthetic enzymes
15294905 NPGPx plays an essential role in breast cancer cells in alleviating oxidative stress generated from polyunsaturated fatty acid metabolism
11368344 HIV-1 Tat causes a greater than 50% decrease in intracellular reduced glutathione (GSH), leading to the extracellular appearance of acidic FGF-1, an effect that is partially mediated through modulation of GSH biosynthetic enzymes
10652368 HIV-1 Tat causes a greater than 50% decrease in intracellular reduced glutathione (GSH), leading to the extracellular appearance of acidic FGF-1, an effect that is partially mediated through modulation of GSH biosynthetic enzymes
9501919 HIV-1 Tat causes a greater than 50% decrease in intracellular reduced glutathione (GSH), leading to the extracellular appearance of acidic FGF-1, an effect that is partially mediated through modulation of GSH biosynthetic enzymes

AA Sequence

MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQL      1 - 70
QRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEP     71 - 140
TWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL                           141 - 187
//

Text Mined References (23)

PMID Year Title
26708178 2015 GPX4 and GPX7 over-expression in human hepatocellular carcinoma tissues.
25586538 2015 Candidate pathway-based genetic association study of platinum and platinum-taxane related toxicity in a cohort of primary lung cancer patients.
25416956 2014 A proteome-scale map of the human interactome network.
24692067 2014 Loss of glutathione peroxidase 7 promotes TNF-?-induced NF-?B activation in Barrett's carcinogenesis.
23919619 2014 Glutathione peroxidase 7 utilizes hydrogen peroxide generated by Ero1? to promote oxidative protein folding.
23828861 2013 Deficiency of NPGPx, an oxidative stress sensor, leads to obesity in mice and human.
23580780 2014 Glutathione peroxidase 7 has potential tumour suppressor functions that are silenced by location-specific methylation in oesophageal adenocarcinoma.
23454490 2013 Protein disulfide isomerase and glutathione are alternative substrates in the one Cys catalytic cycle of glutathione peroxidase 7.
23123197 2012 Loss of the oxidative stress sensor NPGPx compromises GRP78 chaperone activity and induces systemic disease.
22157330 2012 Glutathione peroxidase 7 protects against oxidative DNA damage in oesophageal cells.
21215271 2011 Two endoplasmic reticulum PDI peroxidases increase the efficiency of the use of peroxide during disulfide bond formation.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20200426 2010 Glutathione pathway genetic polymorphisms and lung cancer survival after platinum-based chemotherapy.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15294905 2004 Identification of a novel putative non-selenocysteine containing phospholipid hydroperoxide glutathione peroxidase (NPGPx) essential for alleviating oxidative stress generated from polyunsaturated fatty acids in breast cancer cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.