Property Summary

NCBI Gene PubMed Count 23
PubMed Score 30.02
PubTator Score 13.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (19)

AA Sequence

MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQL      1 - 70
QRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEP     71 - 140
TWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL                           141 - 187
//

Text Mined References (23)

PMID Year Title