Property Summary

NCBI Gene PubMed Count 9
PubMed Score 37.54
PubTator Score 4.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Ovarian epithelial cancer 10 0.0 0.0
Disease Target Count
Epithelial ovarian cancer 9
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Favism 4 3.72 1.9
Keshan disease 17 3.262 1.6

Synonym

Accession P59796 Q4PJ17 GPx-6
Symbols GPX5p
GPXP3
GPx-6
GSHPx-6
dJ1186N24
dJ1186N24.1

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (7)

AA Sequence

MFQQFQASCLVLFFLVGFAQQTLKPQNRKVDCNKGVTGTIYEYGALTLNGEEYIQFKQFAGKHVLFVNVA      1 - 70
AYUGLAAQYPELNALQEELKNFGVIVLAFPCNQFGKQEPGTNSEILLGLKYVCPGSGFVPSFQLFEKGDV     71 - 140
NGEKEQKVFTFLKNSCPPTSDLLGSSSQLFWEPMKVHDIRWNFEKFLVGPDGVPVMHWFHQAPVSTVKSD    141 - 210
ILEYLKQFNTH                                                               211 - 221
//

Text Mined References (10)

PMID Year Title